DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clp and ZC3H4

DIOPT Version :9

Sequence 1:NP_477156.1 Gene:Clp / 33259 FlyBaseID:FBgn0015621 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_055983.1 Gene:ZC3H4 / 23211 HGNCID:17808 Length:1303 Species:Homo sapiens


Alignment Length:292 Identity:60/292 - (20%)
Similarity:90/292 - (30%) Gaps:116/292 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 HIRGDR--TIVCKHWLRGLCKKGDQCEFLHEYDMTKMPE-CYFYSRFNACHNKECPFLHIDPQSK 122
            |.:.|:  .::||:::.|.|..||.|.|.|:.::.|..| |.||........:.||::|.|...|
Human   385 HQQSDKKGKVICKYFVEGRCTWGDHCNFSHDIELPKKRELCKFYITGFCARAENCPYMHGDFPCK 449

  Fly   123 VKDCPWYKRGFCRHGPHCRHQH----------LRRVLCMDYLAGF-------------------- 157
            :    ::..|.|.:|..|...|          |.::|..|..||.                    
Human   450 L----YHTTGNCINGDDCMFSHDPLTEETRELLDKMLADDAEAGAEDEKEVEELKKQGINPLPKP 510

  Fly   158 ---------------------------------------CPEGPSCKHMHPHFELPPLAELGKDQ 183
                                                   .|.||....|..|..|.|.....:|.
Human   511 PPGVGLLPTPPRPPGPQAPTSPNGRPMQGGPPPPPPPPPPPPGPPQMPMPVHEPLSPQQLQQQDM 575

  Fly   184 LHKKLPT-----CHYCGELGHKANSCKQYVGSLEHRNNINAMDHSGGHSG--------GYSGHSG 235
            .:||:|:     ....|:|..|..  .::.|             .||..|        |..|..|
Human   576 YNKKIPSLFEIVVRPTGQLAEKLG--VRFPG-------------PGGPPGPMGPGPNMGPPGPMG 625

  Fly   236 -----------HIEGADDMQSNHHS-QPHGPG 255
                       |.:...||.::.|: .|.|||
Human   626 GPMHPDMHPDMHPDMHPDMHADMHADMPMGPG 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClpNP_477156.1 YTH1 12..175 CDD:227416 37/185 (20%)
ZnF_C3H1 66..90 CDD:214632 9/25 (36%)
ZC3H4NP_055983.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..388 1/2 (50%)
ZnF_C3H1 394..415 CDD:214632 8/20 (40%)
ZnF_C3H1 421..445 CDD:214632 7/23 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 486..571 9/84 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 605..685 14/53 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 710..955
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 996..1288
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.