Sequence 1: | NP_477156.1 | Gene: | Clp / 33259 | FlyBaseID: | FBgn0015621 | Length: | 296 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_055983.1 | Gene: | ZC3H4 / 23211 | HGNCID: | 17808 | Length: | 1303 | Species: | Homo sapiens |
Alignment Length: | 292 | Identity: | 60/292 - (20%) |
---|---|---|---|
Similarity: | 90/292 - (30%) | Gaps: | 116/292 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 61 HIRGDR--TIVCKHWLRGLCKKGDQCEFLHEYDMTKMPE-CYFYSRFNACHNKECPFLHIDPQSK 122
Fly 123 VKDCPWYKRGFCRHGPHCRHQH----------LRRVLCMDYLAGF-------------------- 157
Fly 158 ---------------------------------------CPEGPSCKHMHPHFELPPLAELGKDQ 183
Fly 184 LHKKLPT-----CHYCGELGHKANSCKQYVGSLEHRNNINAMDHSGGHSG--------GYSGHSG 235
Fly 236 -----------HIEGADDMQSNHHS-QPHGPG 255 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Clp | NP_477156.1 | YTH1 | 12..175 | CDD:227416 | 37/185 (20%) |
ZnF_C3H1 | 66..90 | CDD:214632 | 9/25 (36%) | ||
ZC3H4 | NP_055983.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..388 | 1/2 (50%) | |
ZnF_C3H1 | 394..415 | CDD:214632 | 8/20 (40%) | ||
ZnF_C3H1 | 421..445 | CDD:214632 | 7/23 (30%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 486..571 | 9/84 (11%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 605..685 | 14/53 (26%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 710..955 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 996..1288 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5084 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |