DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Clp and Zc3h3

DIOPT Version :9

Sequence 1:	NP_477156.1	Gene:	Clp / 33259	FlyBaseID:	FBgn0015621	Length:	296	Species:	Drosophila melanogaster
Sequence 2:	NP_742119.1	Gene:	Zc3h3 / 223642	MGIID:	2663721	Length:	950	Species:	Mus musculus

Alignment Length:	130	Identity:	44/130 - (33%)
Similarity:	68/130 - (52%)	Gaps:	7/130 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly    41 CNFITRNGQECDKGSACPFRHIRGDRTIVCKHWLRGLCKKGD-QCEFLHEYDMTKMPECYFYSRF 104
            |.:..|.|: |::|..||:.| ..::..||..::||.|||.| .|.|.|.....|||.|.::.:
Mouse   668 CMYYNRFGR-CNRGECCPYIH-DPEKVAVCTRFVRGTCKKTDGSCPFSHHVSKEKMPVCSYFLK- 729

  Fly   105 NACHNKECPFLHIDPQSKVKDCPWYKRGFCRHGPHCRHQHLRRVLCMDYL-AGFCPEGPSCKHMH 168
            ..|.|..||:.|:....|.:.|..:.:|:|..|..|:.:|  .:||.|:. .|.||.|..|:.:|
Mouse   730 GICSNSNCPYSHVYVSRKAEVCSDFLKGYCPLGAKCKKKH--TLLCPDFARRGICPRGSQCQLLH 792

Fly 169 168
Mouse 793 792

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Clp	NP_477156.1	YTH1	12..175	CDD:227416	44/130 (34%)
Clp	NP_477156.1	ZnF_C3H1	66..90	CDD:214632	11/24 (46%)
Zc3h3	NP_742119.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	32..106
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	127..182
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	201..220
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	314..489
		zf-CCCH	663..689	CDD:279036	8/22 (36%)
		ZnF_C3H1	718..743	CDD:214632	9/25 (36%)
		ZnF_C3H1	745..771	CDD:214632	7/27 (26%)
		zf-CCCH	770..792	CDD:279036	8/21 (38%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	793..950		44/130 (34%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5084
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810