DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clp and T26A8.4

DIOPT Version :9

Sequence 1:NP_477156.1 Gene:Clp / 33259 FlyBaseID:FBgn0015621 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_501435.1 Gene:T26A8.4 / 177643 WormBaseID:WBGene00020827 Length:574 Species:Caenorhabditis elegans


Alignment Length:184 Identity:47/184 - (25%)
Similarity:69/184 - (37%) Gaps:52/184 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 QSKVKDCPWYKRGFCRHGPHCRHQH-----LRR-VLCMDYLAGFCPEGPSCKHMHPHFELPPLAE 178
            |::.:.|.:::.|:||.|.:|.:.|     ||| |||..|...||.:|..|..:|..|   |...
 Worm   165 QTEHQICKFFREGYCRDGDNCLYSHQAEDSLRRPVLCNFYANSFCKKGLQCLMLHGEF---PCKS 226

  Fly   179 LGKDQLH------KKLPTCHYCGEL------------GHKANSCKQYVGSLEHRNN--INAMDHS 223
            ..|.|.:      ..:|...|...:            .|:|...:.|      |.|  .||...:
 Worm   227 FHKGQCNHDPCRFSHVPLTDYTRPIIEKILADEEARQAHQAQQAQTY------RQNPVANAAAAA 285

  Fly   224 --------------GG--HSGGYSGHSGHIEGADDMQSNHHSQPHGPGFVKVPT 261
                          ||  .:|....|:..:..|...|::|.||...|..| |||
 Worm   286 AAAQVMPRRRVLLPGGPNMNGSSPPHATPVIHAPIPQASHPSQLPPPAVV-VPT 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClpNP_477156.1 YTH1 12..175 CDD:227416 21/60 (35%)
ZnF_C3H1 66..90 CDD:214632
T26A8.4NP_501435.1 ZnF_C3H1 168..189 CDD:214632 6/20 (30%)
ZnF_C3H1 196..221 CDD:214632 11/24 (46%)
PHA03160 <347..437 CDD:165431
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.