DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clp and CPSF4

DIOPT Version :9

Sequence 1:NP_477156.1 Gene:Clp / 33259 FlyBaseID:FBgn0015621 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_011514057.1 Gene:CPSF4 / 10898 HGNCID:2327 Length:274 Species:Homo sapiens


Alignment Length:313 Identity:159/313 - (50%)
Similarity:193/313 - (61%) Gaps:60/313 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDILLANVSGLQFKAERDLIEQVGAIPLPFYGMDKSIAAVCNFITRNGQECDKGSACPFRHIRGD 65
            |..::|:|..::|..|..:.:|:||.||||.|||||.||||.|..:  ..|.||..||||||.|:
Human     1 MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLK--AACGKGGMCPFRHISGE 63

  Fly    66 RTIVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSRFNACHNKECPFLHIDPQSKVKDCPWYK 130
            :|:||||||||||||||||||||||||||||||||||:|..|.|||||||||||:||:||||||.
Human    64 KTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYD 128

  Fly   131 RGFCRHGPHCRHQHLRRVLCMDYLAGFCPEGPSCKHMH-----PHFEL-------PPLAEL---- 179
            ||||:|||.|||:|.|||:|::||.||||||||||.|.     |.|||       |||.:.    
Human   129 RGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMQLLVTSPRFELPMGTTEQPPLPQQTQPP 193

  Fly   180 GKDQLHKKLPTCHYCGELGHKANS-----CKQYVGSLEHRNNINAMDHSGGHSGGYSGHSGHIEG 239
            .|...:..|.......:|..:.:|     ..|.:|.::.:|:      |.|:.|           
Human   194 AKQSNNPPLQRSSSLIQLTSQNSSPNQQRTPQVIGVMQSQNS------SAGNRG----------- 241

  Fly   240 ADDMQSNHHSQPHGPGFVKVPTPLEEITCYKCGNKGHYANKCPKGHLAFLSNQ 292
                                |.|||::||||||.||||||:|.||||||||.|
Human   242 --------------------PRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClpNP_477156.1 YTH1 12..175 CDD:227416 117/174 (67%)
ZnF_C3H1 66..90 CDD:214632 21/23 (91%)
CPSF4XP_011514057.1 YTH1 <25..>161 CDD:227416 104/137 (76%)
COG5222 <231..>263 CDD:227547 20/68 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141015
Domainoid 1 1.000 145 1.000 Domainoid score I4607
eggNOG 1 0.900 - - E1_COG5084
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38216
Inparanoid 1 1.050 326 1.000 Inparanoid score I2488
Isobase 1 0.950 - 0 Normalized mean entropy S731
OMA 1 1.010 - - QHG49855
OrthoDB 1 1.010 - - D1472764at2759
OrthoFinder 1 1.000 - - FOG0002750
OrthoInspector 1 1.000 - - oto88328
orthoMCL 1 0.900 - - OOG6_103251
Panther 1 1.100 - - LDO PTHR23102
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2013
SonicParanoid 1 1.000 - - X2133
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.