DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clp and zc3h6

DIOPT Version :9

Sequence 1:NP_477156.1 Gene:Clp / 33259 FlyBaseID:FBgn0015621 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001096202.2 Gene:zc3h6 / 100124753 XenbaseID:XB-GENE-6454376 Length:1023 Species:Xenopus tropicalis


Alignment Length:257 Identity:61/257 - (23%)
Similarity:92/257 - (35%) Gaps:80/257 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 VCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSRFNACHNKECPFLHIDPQSKVKDCPWYKRGF 133
            :||::|...|.|||||:|.|:.::.|..|.                           |.:|.:|:
 Frog   271 ICKYFLEKRCIKGDQCKFDHDAEIGKKREI---------------------------CKFYIQGY 308

  Fly   134 CRHGPHCRHQHLRRVLCMDYLAGF-CPEGPSCKHMHPHFELPPLAELGKDQLHKKLPTCHYCGEL 197
            |..|.:|.:.| ....|..|..|. |.:|.:||..|     .||.:..::.|||.|.|    .|:
 Frog   309 CTKGDNCLYMH-NEFPCKFYHTGAKCYQGDNCKFSH-----DPLTDDTRELLHKVLNT----EEV 363

  Fly   198 GHKANSCKQYVGSLE---HRNNIN----AMDHSGGHSGGYSGH------------SGHIE--GAD 241
            .|:..:     |:.|   |....|    .|.:.|.|...|:..            :|.|.  .|.
 Frog   364 QHEDEN-----GASEMPRHGKFYNPPYYGMQYQGCHQPMYNSEPLPESGPNVSPMTGGIPPFNAS 423

  Fly   242 DMQS---NHHSQPH---GPGFVKVPTPLEEITCYKCGNK--GHYANKCPKGHLAFLSNQHSH 295
            .||:   |:....:   .|.|::..........|:|...  |.|.|        :.|.|..|
 Frog   424 TMQNPVINNQRDGYNLSSPPFLQSTEEATHTNSYQCSQNTTGFYDN--------YYSQQAVH 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClpNP_477156.1 YTH1 12..175 CDD:227416 28/106 (26%)
ZnF_C3H1 66..90 CDD:214632 11/20 (55%)
zc3h6NP_001096202.2 zf_CCCH_4 272..290 CDD:375772 10/17 (59%)
zf_CCCH_4 301..319 CDD:375772 6/17 (35%)
zf-CCCH_4 323..344 CDD:375512 8/25 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.