DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGAP2 and CWH43

DIOPT Version :9

Sequence 1:NP_608548.1 Gene:PGAP2 / 33258 FlyBaseID:FBgn0031284 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_009943.2 Gene:CWH43 / 850376 SGDID:S000000610 Length:953 Species:Saccharomyces cerevisiae


Alignment Length:239 Identity:60/239 - (25%)
Similarity:112/239 - (46%) Gaps:50/239 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LPFARLALVALSLPLGGFFFCVI--WSLTFDFV--RSTYTHCDVTNYLPSVSAAIGNYEPQKTVW 78
            :|.|. .:.|.|    .||..::  :||.|..:  .:.||:.|  .:.|||||.||:..|:::::
Yeast     9 IPIAH-TICAFS----AFFAALVTGYSLHFHKIVTNAHYTYPD--EWFPSVSATIGDRYPERSIF 66

  Fly    79 RLAIFLHLPLRLAVAKIYLEHYREHIRRSRRLLGILACFL-NVVEDLALFCLSFWTSADHYETHR 142
            ::.|.|....|..   :.|.||  ::.:|:      .||| .|:..::.....:.||.|.::.|.
Yeast    67 QILIALTAFPRFL---LLLGHY--YLNQSK------VCFLVGVLRTVSCGGWVYITSTDDHDIHD 120

  Fly   143 NAFVVFIACSECYMLVSYLLNRNIQKTVLLPHEEKSLRY-----KRNLFLVNVIAFGLAG---YC 199
                :|        :::|::       :.||.:....||     .:|..|...|.||...   |.
Yeast   121 ----IF--------MITYIV-------LTLPWDIMITRYSSPLTSKNKGLTATIFFGTLFPMIYW 166

  Fly   200 FVRHNSHCEAGVYTFFALFEYIVVLTNMGFHMTSYWDFYALNVV 243
            :::|:....||.|:.:|.||:.::|.::.|...:|.||..:::|
Yeast   167 YIQHSVQQRAGAYSIYAYFEWSLILLDIAFDAFAYADFKKIDIV 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGAP2NP_608548.1 Frag1 19..240 CDD:287278 59/233 (25%)
CWH43NP_009943.2 Frag1 5..207 CDD:402067 59/234 (25%)
Exo_endo_phos 701..911 CDD:397447
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I2895
eggNOG 1 0.900 - - E1_KOG3979
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto99160
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R277
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.