DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGAP2 and pgap2

DIOPT Version :9

Sequence 1:NP_608548.1 Gene:PGAP2 / 33258 FlyBaseID:FBgn0031284 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_005161358.1 Gene:pgap2 / 541417 ZFINID:ZDB-GENE-050320-119 Length:254 Species:Danio rerio


Alignment Length:245 Identity:98/245 - (40%)
Similarity:142/245 - (57%) Gaps:7/245 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DPKSVLFRLPFARLALVALSLPLGGFFFCVIWSLTFDFVRSTYTHCDVTNYLPSVSAAIGNYEPQ 74
            |....|.|:||.|||::.:.|||.|...|::.::.:.:..:|||||.|.|||||:|||| :..|:
Zfish    10 DRDKPLIRVPFTRLAVITVCLPLLGLVACIVLAMLYHYNDATYTHCQVPNYLPSISAAI-SLTPE 73

  Fly    75 KTVWRLAIFLHLPLRLAVAKIYLEHYREHIRR--SRRLLGILACFLNVVEDLALFCLSFWTSADH 137
            :.:||.:|.||...|..||..||..||....|  :.:||......|.:.|::.|..|::.:|.:.
Zfish    74 RYIWRFSIGLHSAPRFLVAAAYLSFYRGRFSRRLTEQLLSGFTFLLALSENVGLLLLTYVSSTET 138

  Fly   138 YETHRNAFVVFIACSECYMLVSYLLNRNIQKTVLLPHEEKSLRYKRNLFLVNVIAFGLAGYCFVR 202
            |..|::.|::||..|..:||.:..|...|.|..:...|..|..:|..|||.|.....||.|.:.|
Zfish   139 YSVHKSGFILFIGSSLFHMLCTCKLWSLIVKYSISSEEMMSYWFKLRLFLFNGGCCVLAVYFYRR 203

  Fly   203 HNSHCEAGVYTFFALFEYIVVLTNMGFHMTSYWDFYALNVVC----DAKH 248
            ||::||.|:||.||:.||:|||:||.||||:||||....|:.    :.||
Zfish   204 HNTYCEEGIYTCFAVCEYLVVLSNMAFHMTAYWDFGGKEVMVATPPEGKH 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGAP2NP_608548.1 Frag1 19..240 CDD:287278 92/222 (41%)
pgap2XP_005161358.1 Frag1 19..241 CDD:287278 92/222 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5356
eggNOG 1 0.900 - - E1_KOG3979
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H121634
Inparanoid 1 1.050 133 1.000 Inparanoid score I4584
OMA 1 1.010 - - QHG56108
OrthoDB 1 1.010 - - D1166083at2759
OrthoFinder 1 1.000 - - FOG0003719
OrthoInspector 1 1.000 - - oto40920
orthoMCL 1 0.900 - - OOG6_107189
Panther 1 1.100 - - LDO PTHR12892
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R277
SonicParanoid 1 1.000 - - X4733
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.960

Return to query results.
Submit another query.