DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGAP2 and ZK185.4

DIOPT Version :9

Sequence 1:NP_608548.1 Gene:PGAP2 / 33258 FlyBaseID:FBgn0031284 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001033462.1 Gene:ZK185.4 / 3896817 WormBaseID:WBGene00044480 Length:281 Species:Caenorhabditis elegans


Alignment Length:255 Identity:65/255 - (25%)
Similarity:99/255 - (38%) Gaps:51/255 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PKSV-LFRLPFARLALVALSLPLGGFFFCVIWSLTFDFVRSTYTHCD-VTNY--------LPSVS 65
            |::| ||:|....|..|....||....|.::.::..        |.| :|||        |||:|
 Worm    15 PQAVELFQLNTTLLFWVGFVPPLFAAVFAILTAIIL--------HQDKITNYAWICGRAFLPSLS 71

  Fly    66 AAIGNYEPQKTVWRLAIFLHLPLRLAVAKI-YLEHYREHIRRSRRLLGI-----LACFLNVVEDL 124
            ..| |...:..||:|.||.|:|.||....: ::.:.|...|.:...|..     |.....|.|.:
 Worm    72 RII-NLTLEGLVWQLCIFFHIPFRLLELSVGWVRYGRLESRANTHRLWYKMHRHLYLVFGVTELI 135

  Fly   125 ALFCLS--------FWTSADHYETHRNAFVVFIACSECYMLVSYLLNRNIQKTVLLPHEEKSLRY 181
            .|..||        .|.....|.....|.:.||:.:.|:....|.||         |:...|...
 Worm   136 LLSGLSAIGEKEHGIWHVCFFYSFGVVALLFFISNTVCHSQSLYFLN---------PYGRISYHV 191

  Fly   182 KRNLFLVNVIAF----GLAGYCFVRHNSHCEAGVYTFFALFEYIVVLTNMGFH-MTSYWD 236
            |   .::::..|    .:|.: :..:...|....|..|||.||:.|...:.:| ...|||
 Worm   192 K---IVISICYFLSAPAIATF-YALYWKACFTWAYELFALVEYLDVFMVIFYHGCCVYWD 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGAP2NP_608548.1 Frag1 19..240 CDD:287278 60/246 (24%)
ZK185.4NP_001033462.1 Frag1 26..251 CDD:287278 60/244 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12892
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.