DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGAP2 and CG15880

DIOPT Version :9

Sequence 1:NP_608548.1 Gene:PGAP2 / 33258 FlyBaseID:FBgn0031284 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_608547.2 Gene:CG15880 / 33257 FlyBaseID:FBgn0031283 Length:263 Species:Drosophila melanogaster


Alignment Length:254 Identity:75/254 - (29%)
Similarity:113/254 - (44%) Gaps:31/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FRLPFAR-LALVALSLPLGGFFFCVIWSL----TFDFVRSTYTHCDVTNYLPSVSAAIGNYEPQK 75
            ||:|... |||..|.||:     |::::|    |.||..:|||.|:..|..||.|||.   :.|.
  Fly    25 FRIPVGPILALGLLQLPV-----CMVYNLVMAITTDFQSTTYTTCNAFNIFPSTSAAA---KSQH 81

  Fly    76 TVWRLAIFLHLPLRLAVAKIYLEHYREHIRRSRRLLGILACFLNVVEDLALFCLSFWTSAD---- 136
            .||.||.:|..|..:|.|.:....||.::||..|..|.|...:..|...::.....:...|    
  Fly    82 KVWALACYLEFPFLIASAWLQFRFYRRNLRRPVRGFGCLMAIIMAVSSSSVLLWGTFPQEDGDSL 146

  Fly   137 -HYETHRNAFVVFIACSECYMLVS-----YLLNRNIQKTVLLPHEEKSLRYKRNLFLVNVIAFGL 195
             |...   |..:|::|: .||..|     |.::..|.:.    |||.|||.|..|.|...:...:
  Fly   147 LHITI---ALSLFVSCA-IYMAGSFVCAKYYMSDRIGQL----HEEFSLRLKSGLVLTYYVWVVV 203

  Fly   196 AGYCFVRHNSHCEAGVYTFFALFEYIVVLTNMGFHMTSYWDFYALNVVCDAKHGLYLSQ 254
            ....:..|...|....|:.|.:.|:|.......:..|.|:|||.:.:..|.:.|.:||:
  Fly   204 MWIFYFIHQKFCFPLAYSVFGMGEFISCECFFIYLCTVYFDFYHVYICYDQRLGFFLSE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGAP2NP_608548.1 Frag1 19..240 CDD:287278 69/235 (29%)
CG15880NP_608547.2 Frag1 32..247 CDD:287278 67/230 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449507
Domainoid 1 1.000 50 1.000 Domainoid score I2895
eggNOG 1 0.900 - - E1_KOG3979
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12892
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.