DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGAP2 and PGAP2

DIOPT Version :9

Sequence 1:NP_608548.1 Gene:PGAP2 / 33258 FlyBaseID:FBgn0031284 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_011518292.2 Gene:PGAP2 / 27315 HGNCID:17893 Length:391 Species:Homo sapiens


Alignment Length:243 Identity:109/243 - (44%)
Similarity:143/243 - (58%) Gaps:28/243 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DPKSVLFRLPFARLALVALSLPLGGFFFCVIWSLTFDFVRSTYTHCDVTNYLPSVSAAIGNYEPQ 74
            ||...||||.|..:...|::.|:.|||||:||||.|.|..:..|.|.|.|||||||:|||...||
Human   146 DPDGTLFRLRFTAMVWWAITFPVFGFFFCIIWSLVFHFEYTVATDCGVPNYLPSVSSAIGGEVPQ 210

  Fly    75 KTVWRLAIFLHLPLRLAVAKIYLEHYREHIRRSRRLLGILACF---------------LNVVEDL 124
            :.|||..|.||...|..||..|..||             |:|.               |||||:|
Human   211 RYVWRFCIGLHSAPRFLVAFAYWNHY-------------LSCTSPCSCYRPLCRLNFGLNVVENL 262

  Fly   125 ALFCLSFWTSADHYETHRNAFVVFIACSECYMLVSYLLNRNIQKTVLLPHEEKSLRYKRNLFLVN 189
            ||..|::.:|::.:..|.|||:||||.|..:||::.:|.|..:|..:...:.||..:|:.||::|
Human   263 ALLVLTYVSSSEDFTIHENAFIVFIASSLGHMLLTCILWRLTKKHTVSQEDRKSYSWKQRLFIIN 327

  Fly   190 VIAFGLAGYCFVRHNSHCEAGVYTFFALFEYIVVLTNMGFHMTSYWDF 237
            .|:|..|...:.|||.:|||||||.||:.||.||||||.||||::|||
Human   328 FISFFSALAVYFRHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWWDF 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGAP2NP_608548.1 Frag1 19..240 CDD:287278 103/234 (44%)
PGAP2XP_011518292.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 198 1.000 Domainoid score I3086
eggNOG 1 0.900 - - E1_KOG3979
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H121634
Inparanoid 1 1.050 203 1.000 Inparanoid score I3757
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56108
OrthoDB 1 1.010 - - D1166083at2759
OrthoFinder 1 1.000 - - FOG0003719
OrthoInspector 1 1.000 - - oto88819
orthoMCL 1 0.900 - - OOG6_107189
Panther 1 1.100 - - LDO PTHR12892
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R277
SonicParanoid 1 1.000 - - X4733
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.