DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGAP2 and Pgap2

DIOPT Version :9

Sequence 1:NP_608548.1 Gene:PGAP2 / 33258 FlyBaseID:FBgn0031284 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001369532.1 Gene:Pgap2 / 233575 MGIID:2385286 Length:266 Species:Mus musculus


Alignment Length:240 Identity:110/240 - (45%)
Similarity:142/240 - (59%) Gaps:16/240 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DPKSVLFRLPFARLALVALSLPLGGFFFCVIWSLTFDFVRSTYTHCDVTNYLPSVSAAIGNYEPQ 74
            |....|.||.|..:||:.:..||..||||::|||.|.|..:|.|||.|.|||||||:|||...||
Mouse    15 DRDGTLVRLRFTMVALITVCCPLVAFFFCILWSLLFHFKETTSTHCGVPNYLPSVSSAIGGEVPQ 79

  Fly    75 KTVWRLAIFLHLPLRLAVAKIYLEHYREHIR--RSRRLLGILACFLNVVEDLALFCLSFWTSADH 137
            :.|||..|.||...|...|..|..||.....  ...|||..:...|||||:|||..|::.:|::.
Mouse    80 RYVWRFCIGLHSAPRFLTAFAYWNHYLSCASPCPGYRLLCRINFSLNVVENLALLVLTYVSSSED 144

  Fly   138 YE----------THRNAFVVFIACSECYMLVSYLLNRNIQKTVLLPHEEKSLRYKRNLFLVNVIA 192
            :.          .|.|||:||||.|..|||::.:|.|..:|..    :.||..:|:.||::|.|:
Mouse   145 FRWCPSSSLPPAIHENAFIVFIAASLGYMLLTCILWRLTKKHT----DRKSYSWKQRLFVINFIS 205

  Fly   193 FGLAGYCFVRHNSHCEAGVYTFFALFEYIVVLTNMGFHMTSYWDF 237
            |..|...:.|||.:|||||||.||:.||.||||||.||||::|||
Mouse   206 FFSALAVYFRHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWWDF 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGAP2NP_608548.1 Frag1 19..240 CDD:287278 106/231 (46%)
Pgap2NP_001369532.1 Frag1 24..253 CDD:402067 106/231 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 203 1.000 Domainoid score I2963
eggNOG 1 0.900 - - E1_KOG3979
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 208 1.000 Inparanoid score I3688
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56108
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003719
OrthoInspector 1 1.000 - - oto92383
orthoMCL 1 0.900 - - OOG6_107189
Panther 1 1.100 - - LDO PTHR12892
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R277
SonicParanoid 1 1.000 - - X4733
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.