DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGAP2 and Y38F1A.8

DIOPT Version :9

Sequence 1:NP_608548.1 Gene:PGAP2 / 33258 FlyBaseID:FBgn0031284 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_496766.1 Gene:Y38F1A.8 / 189674 WormBaseID:WBGene00012610 Length:303 Species:Caenorhabditis elegans


Alignment Length:260 Identity:71/260 - (27%)
Similarity:111/260 - (42%) Gaps:45/260 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PTYERFSDPKSVLFRLPFARLALVALSLPLGGFFFCVIWSLTFDFVR-STYTHC------DVTNY 60
            |......|....:.|:.:. :.|.|| ||..|.:|.|.::..|.|.: |.:|.|      ::|  
 Worm    28 PMKSPIEDTVEKMLRIRWV-VCLGAL-LPGAGCYFVVAYTYLFQFEKVSNFTECKECPNMNIT-- 88

  Fly    61 LPSVSAAIGNYEPQKTVWRLAIFLHLPLRLAVAKIYLEHYREHIRRSRRLLGILA------CFLN 119
            ||.||.:||.::|||.:|.:.:|:|:|.||....:|           |||..|.|      ..:|
 Worm    89 LPPVSYSIGIWQPQKYIWMMIMFIHVPPRLFFLMLY-----------RRLFLISAPKSVWYARVN 142

  Fly   120 VV-------EDLALFCLSFWTSADHYETHRNAFVVFIACSECYMLVSYLLN-----RNIQKTVLL 172
            .|       |.|.|..:|.......:..|...|.::|.|....||.:.:|:     |::..|:  
 Worm   143 YVYMLTLWAEPLGLVLVSVVDINGGFILHALGFAIWIICFNFNMLFNIILHHFGGCRDVHDTM-- 205

  Fly   173 PHEEKSLRYKRNLFLVNVIAFGLAGYCFVRHNSHCEAGVYTFFALFEYIVVLTNMGFHMTSYWDF 237
               |.:.|.|..:|||...........:....:||....|..|:|.|.|.|..|..|:..:|::|
 Worm   206 ---ETTWRIKCVIFLVGYFCAISTPITYPYFTAHCSPYAYNLFSLAELIEVGCNSLFYSIAYFEF 267

  Fly   238  237
             Worm   268  267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGAP2NP_608548.1 Frag1 19..240 CDD:287278 68/244 (28%)
Y38F1A.8NP_496766.1 Frag1 45..269 CDD:287278 68/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3979
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003719
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12892
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.