DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGAP2 and Y11D7A.9

DIOPT Version :9

Sequence 1:NP_608548.1 Gene:PGAP2 / 33258 FlyBaseID:FBgn0031284 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_501615.1 Gene:Y11D7A.9 / 189434 WormBaseID:WBGene00012433 Length:297 Species:Caenorhabditis elegans


Alignment Length:228 Identity:55/228 - (24%)
Similarity:98/228 - (42%) Gaps:34/228 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LGGFFFCVIWSLTFDFVRSTYTHCDVTNY--------LPSVSAAIGNYEPQKTVWRLAIFLHLPL 88
            |.||...:..|::...:...:.:.:::||        |||:|..| |...::|.|:|.:..|:|:
 Worm    49 LAGFIPPMFGSISAIAIALIFHNDEISNYNWQCGRARLPSLSRII-NLPVERTFWQLFLLFHVPI 112

  Fly    89 RLAVAKIYLEHYR--EHIRRSRRLLGILACFL----NVVEDLALFCLSFWTSADHYETHRNAFVV 147
            |:.........|:  .::...|..|..|:.:|    .::|.:.|..||.....::.:.|...|.|
 Worm   113 RVVELITGFSRYKRMRNVNYKRVWLYELSRYLYFVVGLLELIFLSGLSIIGERENIQVHVIFFYV 177

  Fly   148 FIACSECYMLVS--------YLLNRNIQKTVLLPHEEKSLRYKRNLFL-VNVIAFGLAGYCFVRH 203
            |..|...:|:.:        |.||         |:...|. |.:.||. :.|::..:....|:.:
 Worm   178 FGICGIVHMISNIFCHAHSLYYLN---------PYGRLSY-YLKILFTSLYVLSTPILIASFILY 232

  Fly   204 NSHCEAGVYTFFALFEYIVVLTNMGFHMTSYWD 236
            ...|....|..|||.||..|..|:.||..:::|
 Worm   233 WRKCITWAYDVFALCEYSGVFLNICFHGCAFFD 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGAP2NP_608548.1 Frag1 19..240 CDD:287278 55/228 (24%)
Y11D7A.9NP_501615.1 Frag1 47..269 CDD:287278 55/228 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3979
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12892
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.