DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGAP2 and T23B12.5

DIOPT Version :9

Sequence 1:NP_608548.1 Gene:PGAP2 / 33258 FlyBaseID:FBgn0031284 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_505176.2 Gene:T23B12.5 / 188777 WormBaseID:WBGene00020720 Length:253 Species:Caenorhabditis elegans


Alignment Length:244 Identity:62/244 - (25%)
Similarity:102/244 - (41%) Gaps:20/244 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LPTYERFSDPKSVL----FRLPFARLALVALSLPLGGFF--FCVIWSLTFDFVRSTYTHCDVTNY 60
            :||| ||...:..:    |:|..|..|  |:::|..|..  |.:.:|:....:.:....|.:. |
 Worm     1 MPTY-RFEASRGPVVLGSFQLKHAFQA--AVTMPAAGIVLAFLIGYSIHTSLMYNYSWGCRIV-Y 61

  Fly    61 LPSVSAAIGNYEPQKTVWRLAIFLHLPLRLAVAKIYLEHYREHIRRSRR--LLGILACFLNVVED 123
            |||||..: |...::..|.......:||:|.|.   |..|......|.:  ||.|.....:|.:.
 Worm    62 LPSVSRLL-NLPLERIFWNFLSLSSVPLQLFVV---LRQYMLTFSTSNKLQLLRITLVISSVFQT 122

  Fly   124 LALFCLSFWTSADHYETHRNAFVVFIACSECYMLVSYLLNRNIQKTVLLPHEEKSLRYKRNLFLV 188
            |.|..|:.....:..:.|    |.|.:......:|:|.:...:.|........|..|.:..:.|.
 Worm   123 LFLTLLATVGERESGDFH----VAFFSGFAVSTIVNYSVFTILMKFTASKESPKHGRRRVAVLLG 183

  Fly   189 NVIAFGLAGYCFVRHNSHCEAGVYTFFALFEYIVVLTNMGFHMTSYWDF 237
            .|:........|:.||..|..|.|..||:|||:.:.....|||::::.|
 Worm   184 LVVTLPTIFIAFIAHNVFCVKGAYEAFAIFEYLTIFLIYAFHMSNFYLF 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGAP2NP_608548.1 Frag1 19..240 CDD:287278 55/223 (25%)
T23B12.5NP_505176.2 Frag1 26..234 CDD:370945 54/218 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3979
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12892
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.