DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGAP2 and pgap-2

DIOPT Version :9

Sequence 1:NP_608548.1 Gene:PGAP2 / 33258 FlyBaseID:FBgn0031284 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001369853.1 Gene:pgap-2 / 188041 WormBaseID:WBGene00007045 Length:263 Species:Caenorhabditis elegans


Alignment Length:244 Identity:93/244 - (38%)
Similarity:133/244 - (54%) Gaps:12/244 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LFRLPFARLALVALSLPLGGFFFCVIWSLTFDFVRSTYTHCDVTNYLPSVSAAIGNYEPQKTVWR 79
            :..:||....:....||......|||.||...|.::|.|||:|.|:|||:|||:..|.|:|.:||
 Worm     8 ILSIPFKYFVICIGGLPSSALLICVILSLLLHFDQATSTHCEVANWLPSISAAVSTYTPEKYIWR 72

  Fly    80 LAIFLHLPLRLAVAKIY--------LEHYREHIRRSRRLLGILACFLNVVEDLALFCLSFWTSAD 136
            :.|.||:..||.||..:        |.....|.|  .|.|..||||||::|:..|..|:..:|::
 Worm    73 ILIGLHIGPRLVVAIAFRNFLLGSPLRPLTGHKR--LRFLCNLACFLNLLENFFLLALTSISSSE 135

  Fly   137 HYETHRNAFVVFIACSECYMLVS-YLLNRNIQKTVLLPHEEKSLRYKRNLFLVNVIAFGLAGYCF 200
            .:..|...|..|..||..|||:| :|.|...::|. ....::|..||.....:.|:.|.|..|.:
 Worm   136 DHSLHAKCFGGFAICSIIYMLLSTWLFNETGRRTA-TNLGQRSHEYKILGAAIFVLCFFLGAYLY 199

  Fly   201 VRHNSHCEAGVYTFFALFEYIVVLTNMGFHMTSYWDFYALNVVCDAKHG 249
            .|||::||.|:||.|||.||..||:|:.||.|.|:||:..|:|..:..|
 Worm   200 WRHNTYCEPGIYTLFALVEYSAVLSNIFFHCTLYYDFHGKNIVLTSSFG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGAP2NP_608548.1 Frag1 19..240 CDD:287278 90/229 (39%)
pgap-2NP_001369853.1 Frag1 12..239 CDD:402067 90/229 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159530
Domainoid 1 1.000 151 1.000 Domainoid score I2674
eggNOG 1 0.900 - - E1_KOG3979
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H121634
Inparanoid 1 1.050 160 1.000 Inparanoid score I2876
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56108
OrthoDB 1 1.010 - - D1166083at2759
OrthoFinder 1 1.000 - - FOG0003719
OrthoInspector 1 1.000 - - oto17520
orthoMCL 1 0.900 - - OOG6_107189
Panther 1 1.100 - - LDO PTHR12892
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R277
SonicParanoid 1 1.000 - - X4733
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.