DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGAP2 and F36H9.5

DIOPT Version :9

Sequence 1:NP_608548.1 Gene:PGAP2 / 33258 FlyBaseID:FBgn0031284 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_503503.1 Gene:F36H9.5 / 185391 WormBaseID:WBGene00018113 Length:352 Species:Caenorhabditis elegans


Alignment Length:269 Identity:55/269 - (20%)
Similarity:96/269 - (35%) Gaps:78/269 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LTFDFVRST--YTHCDVTNYLPSVSAAI-GNYEP------------------------------- 73
            |.|..:|::  :|...||.::.:|.||: .||.|                               
 Worm    54 LDFPLLRASLIFTFISVTAFVAAVLAALPTNYTPLLDEELVDNSIIIWYGAKVYRCRTFFTYPKD 118

  Fly    74 ---------QKTVW-----RLAIFLHLPLRLAVAKIYLE-----HYREHIRRSRRLLGILACFLN 119
                     :..||     |||..|.:.:|...:.::..     .:||......|.|..|...|.
 Worm   119 GLLSILNLLELNVWGNVIFRLATCLTIAVRFFQSIVFRNLLINGFWREVPNPMFRWLCDLLPMLT 183

  Fly   120 VVEDLALFCLSFWTSADHYE--TH--RNAFVVFIACSECY-MLVSYLLNRNIQKTVLLPHEEKSL 179
            ::|..||...|..|....::  .|  ::.|.:....:.|. .:..::|:.|..|           
 Worm   184 LIETTALAMFSIITMHSDFKEINHFCKSTFAIVSVVNMCIPTIFHFVLSINSSK----------- 237

  Fly   180 RYKRNLFLVNVIAFGLAGYC----FVRH-----NSHCEAGVYTFFALFEYIVVLTNMGFHMTSYW 235
            :.:.::..|..:...:.|||    |..|     .|.|.:.:...||:.||.:.|..:.||:.|..
 Worm   238 KAEASIVFVRAVCAVVFGYCAPQYFQFHIGWTKESLCHSYIPRHFAIMEYSLFLAYITFHLLSLL 302

  Fly   236 DFYALNVVC 244
            |.:.|..:|
 Worm   303 DLHHLQFIC 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGAP2NP_608548.1 Frag1 19..240 CDD:287278 53/263 (20%)
F36H9.5NP_503503.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12892
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.