DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGAP2 and C14B9.3

DIOPT Version :9

Sequence 1:NP_608548.1 Gene:PGAP2 / 33258 FlyBaseID:FBgn0031284 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_498771.1 Gene:C14B9.3 / 176144 WormBaseID:WBGene00015753 Length:348 Species:Caenorhabditis elegans


Alignment Length:284 Identity:58/284 - (20%)
Similarity:109/284 - (38%) Gaps:60/284 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YERFSDPKSVLFRLPFARL--ALVALSLPLGGFFFCVIWSLTFDFV--------------RSTYT 53
            |....|..|.:..|.|..:  :||...:.:|.|...:..||..|::              .|:..
 Worm    42 YGHAEDDNSDIAYLNFPVIVPSLVFTVISMGCFVGGIFTSLKSDYIPDERELIRGYVIEYGSSRF 106

  Fly    54 HCDVT-----NYLPSV-----SAAIGNYEPQKTVWRLAIFLHLPLRLAVA---KIYLEHYREHIR 105
            .|:.|     :.|||:     ...|||     .::|.|:.:.:.:|:..|   :..|.|  |:.:
 Worm   107 RCNTTIPFPADGLPSILNLFELNVIGN-----VLFRYAVCIPIVIRVFNALTIRNLLRH--EYDK 164

  Fly   106 RSRRLLGILACFLNVVEDLALFCLSFWT----SADHYETHRNAFVVFIACSECYMLVSYLLNRNI 166
            :...|..::|..:.:...:..|.:|.::    ..|..|.:|...:||...|    :||.|....:
 Worm   165 KFSSLHKVMADSMPIFTFVEAFMMSLFSIVTVHEDFPEANRFFKIVFAMSS----VVSMLTTTTV 225

  Fly   167 QKTVLLPHEEKSLRYKRNLFLVNVIAFGLAGYCFVR------HNSH-----CEAGVYTFFALFEY 220
            ........|.|.......:.|::|:.     |.::.      |.|.     |.:.:...|||.||
 Worm   226 MFAFSSNSESKWDTVSMIMKLISVVI-----YVYLMPQYMQYHQSSITFPICHSYMPQLFALMEY 285

  Fly   221 IVVLTNMGFHMTSYWDFYALNVVC 244
            .:::....||::...|...::.:|
 Worm   286 FIIIAYATFHLSFLIDIRNISFIC 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGAP2NP_608548.1 Frag1 19..240 CDD:287278 53/264 (20%)
C14B9.3NP_498771.1 Frag1 <179..305 CDD:287278 27/134 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12892
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.