DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGAP2 and pgap2

DIOPT Version :9

Sequence 1:NP_608548.1 Gene:PGAP2 / 33258 FlyBaseID:FBgn0031284 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_031751495.1 Gene:pgap2 / 100127662 XenbaseID:XB-GENE-6454013 Length:268 Species:Xenopus tropicalis


Alignment Length:253 Identity:101/253 - (39%)
Similarity:135/253 - (53%) Gaps:19/253 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LPTYERFSDPKSVLFRLP---------------FARLALVALSLPLGGFFFCVIWSLTFDFVRST 51
            :||......|..|:|| |               |...|:..:||||..|.||::|||.|:|.|..
 Frog     3 IPTDRDRHVPTHVIFR-PTFRGPELGQLALSHSFTTFAVGTVSLPLFAFLFCIVWSLLFNFSRDE 66

  Fly    52 YTHCDVTNYLPSVSAAIGNYEPQKTVWRLAIFLHLPLRLAVAKIYLEHYREHIRRSRRL--LGIL 114
             .|....|||||||||||...||:.:|||.|.||...|..|...||.:|:.....|...  |..|
 Frog    67 -LHATGPNYLPSVSAAIGGETPQRYIWRLCIGLHSAPRFLVGVAYLHYYQGTPCSSPAYPRLCHL 130

  Fly   115 ACFLNVVEDLALFCLSFWTSADHYETHRNAFVVFIACSECYMLVSYLLNRNIQKTVLLPHEEKSL 179
            ...||..|...|..|::.:|:::||.|:..|:.|:..|..||.|:..|.|..:|......|..|.
 Frog   131 NFLLNCCEIFFLILLTYVSSSENYEVHKLGFMAFMLFSVGYMFVTCSLWRVARKGSGSLEERTSY 195

  Fly   180 RYKRNLFLVNVIAFGLAGYCFVRHNSHCEAGVYTFFALFEYIVVLTNMGFHMTSYWDF 237
            .:|:.||...::.|..:...::.||.:|||||||.|||.||:|||:|||||||::|||
 Frog   196 AWKKRLFGFYLLMFLSSILVYIWHNMYCEAGVYTVFALLEYLVVLSNMGFHMTAWWDF 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGAP2NP_608548.1 Frag1 19..240 CDD:287278 95/236 (40%)
pgap2XP_031751495.1 Frag1 34..256 CDD:402067 94/221 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 175 1.000 Domainoid score I3598
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I3901
OMA 1 1.010 - - QHG56108
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003719
OrthoInspector 1 1.000 - - otm47760
Panther 1 1.100 - - LDO PTHR12892
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R277
SonicParanoid 1 1.000 - - X4733
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1111.100

Return to query results.
Submit another query.