DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15880 and CWH43

DIOPT Version :9

Sequence 1:NP_608547.2 Gene:CG15880 / 33257 FlyBaseID:FBgn0031283 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_009943.2 Gene:CWH43 / 850376 SGDID:S000000610 Length:953 Species:Saccharomyces cerevisiae


Alignment Length:352 Identity:65/352 - (18%)
Similarity:113/352 - (32%) Gaps:147/352 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QARRHFRIPVGPILALG--LLQLP----VCMVYNLVMAITTDFQSTTYTTCNAFNIFPSTSAAAK 78
            :|...:.:.:|.|:|:|  ::|:|    :.:.....:.:.|..|:..|.| ||...|        
Yeast   326 EAFTQYGVLLGGIIAIGAYIVQMPELRLISVAVGTSITVATFVQNLRYIT-NAETSF-------- 381

  Fly    79 SQHKVWALACYLEFPFLIASAWLQFRFY------------------------------------- 106
            |....|.|.       |:||..|:..||                                     
Yeast   382 SFALTWLLG-------LVASVILKMGFYTNNPTWVILDERNGGYNKTALVLTVLFGMLSPYVNSI 439

  Fly   107 ----RRNLRRP----------VRGFGCLMAII--MAVSSSSVLLW---------GTFPQEDGDSL 146
                :||.:..          ..|||.|:..|  :...||:.:.|         |..|...|   
Yeast   440 NFEGKRNAQAKSASLIGKLFLAVGFGSLLFGIHQLLTDSSTTIYWAWEGYNESHGPLPWPWG--- 501

  Fly   147 LHITIALSLFVS-------------CAIYMAGSFVCA--------KY-----------------Y 173
             .:|..:.||.|             |.:.:..:.|.:        ||                 |
Yeast   502 -ALTCTVMLFASLSSVKFMGKPLVPCLLLLISTAVLSARSITQWPKYIFGGLLYAIAMLWLVPSY 565

  Fly   174 MSDRIGQLHEEFSLRLKSGLVLTY---YVWVVVM------WIFYFIHQKFCFPLAYS----VFGM 225
            .| .:||:...:...|...:.:.:   :||||..      |:   :.:|....||:|    :.|.
Yeast   566 FS-ALGQVQNIWVYVLSFSVYIIFVLAHVWVVAYAFVPMGWV---LREKIETVLAFSSTFIIIGA 626

  Fly   226 GEFISCECFFIYLCTVYFDFYHVYICY 252
               ::|:...|.|.|:...|: :|:.:
Yeast   627 ---LTCKNLNIQLVTMGKKFF-IYVFF 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15880NP_608547.2 Frag1 32..247 CDD:287278 62/333 (19%)
CWH43NP_009943.2 Frag1 5..207 CDD:402067
Exo_endo_phos 701..911 CDD:397447
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I2895
eggNOG 1 0.900 - - E1_KOG3979
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.