DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15880 and ZK185.4

DIOPT Version :9

Sequence 1:NP_608547.2 Gene:CG15880 / 33257 FlyBaseID:FBgn0031283 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001033462.1 Gene:ZK185.4 / 3896817 WormBaseID:WBGene00044480 Length:281 Species:Caenorhabditis elegans


Alignment Length:251 Identity:50/251 - (19%)
Similarity:92/251 - (36%) Gaps:54/251 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ALGLLQLPVCM---------VYNLVMAITTDF-----QSTTYTTCNAFNIFPSTSAAAK--SQHK 82
            |:.|.||...:         ::..|.||.|..     :.|.|.........||.|....  .:..
 Worm    17 AVELFQLNTTLLFWVGFVPPLFAAVFAILTAIILHQDKITNYAWICGRAFLPSLSRIINLTLEGL 81

  Fly    83 VWALACYLEFPFL---IASAWLQF----------RFYRRNLRRPVRGFG----CLMAIIMAVSSS 130
            ||.|..:...||.   ::..|:::          |.:.:..|.....||    .|::.:.|:...
 Worm    82 VWQLCIFFHIPFRLLELSVGWVRYGRLESRANTHRLWYKMHRHLYLVFGVTELILLSGLSAIGEK 146

  Fly   131 SVLLWGTFPQEDGDSLLHITIALSLFVSCAIYMAGSFVC---AKYYMSDRIGQLHEEFSLRLKSG 192
            ...:|            |:....|..|...::...:.||   :.|:::.     :...|..:|..
 Worm   147 EHGIW------------HVCFFYSFGVVALLFFISNTVCHSQSLYFLNP-----YGRISYHVKIV 194

  Fly   193 LVLTYYVWVVVMWIFYFIHQKFCFPLAYSVFGMGEFISC-ECFFIYLCTVYFDFYH 247
            :.:.|::....:..||.::.|.||..||.:|.:.|::.. ...|.:.|.||:|..|
 Worm   195 ISICYFLSAPAIATFYALYWKACFTWAYELFALVEYLDVFMVIFYHGCCVYWDIQH 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15880NP_608547.2 Frag1 32..247 CDD:287278 49/249 (20%)
ZK185.4NP_001033462.1 Frag1 26..251 CDD:287278 46/242 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12892
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.970

Return to query results.
Submit another query.