DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15880 and CG7990

DIOPT Version :9

Sequence 1:NP_608547.2 Gene:CG15880 / 33257 FlyBaseID:FBgn0031283 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_573361.1 Gene:CG7990 / 32909 FlyBaseID:FBgn0030997 Length:325 Species:Drosophila melanogaster


Alignment Length:228 Identity:54/228 - (23%)
Similarity:91/228 - (39%) Gaps:28/228 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LPVCMVYN-LVMAITTDFQSTTYTTCNAFNIFPSTSA--AAKSQHKVWALACYLEFPFLIASAWL 101
            ||:..::. .|.|....:.....|.|..:||.||.||  ....|...|..:..|.....|..|::
  Fly    85 LPLVTLFTCFVTAYVFQYDDVHETHCRVYNIIPSISAITGVSPQRYFWRFSIALHIGPRIPIAFV 149

  Fly   102 QFRFYRRNLRR----PVRGFGCLMAIIMAVSSSSVLLWG--TFPQEDGDSLLHITIALSLFVSCA 160
            ...:||..|||    .|.....|:.:|:.::...:...|  |:.....:..:|..|.::..|...
  Fly   150 YKNYYRSQLRRISPAQVPQTSLLITLILVLNCIEIASLGGVTYISNRENYPVHERIFITFMVCSL 214

  Fly   161 IYMAGS-----FVCAKYYMSDRIGQLHEEFSLRLKSGLVLTYYVWVVVMWIFYFIHQKFCFPLAY 220
            .||..:     .:.|...:|::  ||   .|::.|..|.....:..|.:.:|:..|:.:|..||:
  Fly   215 CYMLATIKLNGILNAGQALSEK--QL---LSIKWKKILFAVSILSTVGLLVFFAKHRFYCHDLAF 274

  Fly   221 SVFGMGEFISCECFFIYLCTVYFDFYHVYICYD 253
            |.|         .||.||..:....:|..|.:|
  Fly   275 SWF---------AFFEYLIAIANMLFHFTIIWD 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15880NP_608547.2 Frag1 32..247 CDD:287278 51/220 (23%)
CG7990NP_573361.1 Frag1 74..300 CDD:287278 54/228 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449506
Domainoid 1 1.000 50 1.000 Domainoid score I2895
eggNOG 1 0.900 - - E1_KOG3979
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12892
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.