DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15880 and PGAP2

DIOPT Version :9

Sequence 1:NP_608547.2 Gene:CG15880 / 33257 FlyBaseID:FBgn0031283 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_011518292.2 Gene:PGAP2 / 27315 HGNCID:17893 Length:391 Species:Homo sapiens


Alignment Length:286 Identity:60/286 - (20%)
Similarity:103/286 - (36%) Gaps:70/286 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLHFVEDQA--------KLLPSSIKDLQARRHFRIPVGPILALGL-------LQLPV-----CMV 45
            :.||.|..|        ::..::.:.|.       |.|.:..|..       :..||     |::
Human   119 LFHFKETTATHCGATPCRMFSAASQPLD-------PDGTLFRLRFTAMVWWAITFPVFGFFFCII 176

  Fly    46 YNLVMAITTDFQSTTYTTCNAFNIFPSTSAAAKS---QHKVWALACYLEFP--FLIASAWLQFRF 105
            ::||.    .|:.|..|.|...|..||.|:|...   |..||.....|...  ||:|     |.:
Human   177 WSLVF----HFEYTVATDCGVPNYLPSVSSAIGGEVPQRYVWRFCIGLHSAPRFLVA-----FAY 232

  Fly   106 YRRNLR--------RPVRGFGCLMAIIMAVSSSSVLLWGTFPQEDGDSLLH-----ITIALSL-- 155
            :...|.        ||:    |.:...:.|..:..||..|:.....|..:|     :.||.||  
Human   233 WNHYLSCTSPCSCYRPL----CRLNFGLNVVENLALLVLTYVSSSEDFTIHENAFIVFIASSLGH 293

  Fly   156 -FVSCAIYMAGSFVCAKYYMSDRIGQLHEEFSLRLKSGLVLTYYVWVVVMWIFYFIHQKFCFPLA 219
             .::|.::.    :..|:.:|.     .:..|...|..|.:..::........||.|..:|....
Human   294 MLLTCILWR----LTKKHTVSQ-----EDRKSYSWKQRLFIINFISFFSALAVYFRHNMYCEAGV 349

  Fly   220 YSVFGMGEFISCECFFIYLCTVYFDF 245
            |::|.:.|:........:..|.::||
Human   350 YTIFAILEYTVVLTNMAFHMTAWWDF 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15880NP_608547.2 Frag1 32..247 CDD:287278 53/247 (21%)
PGAP2XP_011518292.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147523
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3979
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12892
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.