DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15880 and Pgap2

DIOPT Version :9

Sequence 1:NP_608547.2 Gene:CG15880 / 33257 FlyBaseID:FBgn0031283 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001369532.1 Gene:Pgap2 / 233575 MGIID:2385286 Length:266 Species:Mus musculus


Alignment Length:227 Identity:47/227 - (20%)
Similarity:84/227 - (37%) Gaps:43/227 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 CMVYNLVMAITTDFQSTTYTTCNAFNIFPSTSAAAKS---QHKVWALACYLEFPFLIASAWLQFR 104
            |::::|:.    .|:.||.|.|...|..||.|:|...   |..||.....|.......:|:..:.
Mouse    43 CILWSLLF----HFKETTSTHCGVPNYLPSVSSAIGGEVPQRYVWRFCIGLHSAPRFLTAFAYWN 103

  Fly   105 FYRRNLRRPVRGFGCL--------------MAIIMAVSSSSVLLW---GTFPQEDGDSLLHITIA 152
            .| .:...|..|:..|              :.::..||||....|   .:.|....::...:.||
Mouse   104 HY-LSCASPCPGYRLLCRINFSLNVVENLALLVLTYVSSSEDFRWCPSSSLPPAIHENAFIVFIA 167

  Fly   153 LSL---FVSCAIYMAGSFVCAKYYMSDRIGQLH-EEFSLRLKSGLVLTYYVWVVVMWIFYFIHQK 213
            .||   .::|.::              |:.:.| :..|...|..|.:..::........||.|..
Mouse   168 ASLGYMLLTCILW--------------RLTKKHTDRKSYSWKQRLFVINFISFFSALAVYFRHNM 218

  Fly   214 FCFPLAYSVFGMGEFISCECFFIYLCTVYFDF 245
            :|....|::|.:.|:........:..|.::||
Mouse   219 YCEAGVYTIFAILEYTVVLTNMAFHMTAWWDF 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15880NP_608547.2 Frag1 32..247 CDD:287278 47/227 (21%)
Pgap2NP_001369532.1 Frag1 24..253 CDD:402067 47/227 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837602
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3979
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12892
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.