DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15880 and Y38F1A.8

DIOPT Version :9

Sequence 1:NP_608547.2 Gene:CG15880 / 33257 FlyBaseID:FBgn0031283 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_496766.1 Gene:Y38F1A.8 / 189674 WormBaseID:WBGene00012610 Length:303 Species:Caenorhabditis elegans


Alignment Length:270 Identity:58/270 - (21%)
Similarity:105/270 - (38%) Gaps:53/270 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DQAKL----LPSSIKDLQARRHFRIPVGPILALGLLQLPVCMVYNLVMAITTDFQ---STTYTTC 64
            ::|||    :.|.|:|...:   .:.:..::.||.| ||....| .|:|.|..||   .:.:|.|
 Worm    20 EKAKLKKEPMKSPIEDTVEK---MLRIRWVVCLGAL-LPGAGCY-FVVAYTYLFQFEKVSNFTEC 79

  Fly    65 NA---FNI-FPSTSAAA---KSQHKVWALACYLEFP------------FLIA---SAWLQFRFYR 107
            ..   .|| .|..|.:.   :.|..:|.:..::..|            |||:   |.|.....|.
 Worm    80 KECPNMNITLPPVSYSIGIWQPQKYIWMMIMFIHVPPRLFFLMLYRRLFLISAPKSVWYARVNYV 144

  Fly   108 RNLRRPVRGFGCLMAIIMAVSSSSVLLWGTFPQEDGDSLLHITIALSLFVSCAIYMAGSFVCAKY 172
            ..|.......|.::..::.:              :|..:|| .:..::::.|..:.....:...:
 Worm   145 YMLTLWAEPLGLVLVSVVDI--------------NGGFILH-ALGFAIWIICFNFNMLFNIILHH 194

  Fly   173 YMSDRIGQLHE--EFSLRLKSGLVLTYYVWVVVMWIFYFIHQKFCFPLAYSVFGMGEFISCECFF 235
            :...|  .:|:  |.:.|:|..:.|..|...:...|.|......|.|.||::|.:.|.|...|..
 Worm   195 FGGCR--DVHDTMETTWRIKCVIFLVGYFCAISTPITYPYFTAHCSPYAYNLFSLAELIEVGCNS 257

  Fly   236 IYLCTVYFDF 245
            ::....||:|
 Worm   258 LFYSIAYFEF 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15880NP_608547.2 Frag1 32..247 CDD:287278 52/241 (22%)
Y38F1A.8NP_496766.1 Frag1 45..269 CDD:287278 52/242 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159524
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3979
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12892
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.