DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15880 and T23B12.5

DIOPT Version :9

Sequence 1:NP_608547.2 Gene:CG15880 / 33257 FlyBaseID:FBgn0031283 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_505176.2 Gene:T23B12.5 / 188777 WormBaseID:WBGene00020720 Length:253 Species:Caenorhabditis elegans


Alignment Length:145 Identity:30/145 - (20%)
Similarity:61/145 - (42%) Gaps:24/145 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 LMAIIMAVSSSSVLLWGTF-----PQEDGDSLLHIT----IALSLFVSCAIYMAGSFVCAKYYMS 175
            |:.|.:.:||....|:.|.     .:|.||  .|:.    .|:|..|:.::     |.....:.:
 Worm   109 LLRITLVISSVFQTLFLTLLATVGERESGD--FHVAFFSGFAVSTIVNYSV-----FTILMKFTA 166

  Fly   176 DRIGQLHEEFSLRLKSGLVLTYYVWVVVMWIFYFIHQKFCFPLAYSVFGMGEFISCECFFIYLCT 240
            .:....|....:.:..|||:|    :..::|.:..|..||...||..|.:.|:::....:.:..:
 Worm   167 SKESPKHGRRRVAVLLGLVVT----LPTIFIAFIAHNVFCVKGAYEAFAIFEYLTIFLIYAFHMS 227

  Fly   241 VYFDF----YHVYIC 251
            .::.|    :.:.||
 Worm   228 NFYLFSNPSHRILIC 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15880NP_608547.2 Frag1 32..247 CDD:287278 28/139 (20%)
T23B12.5NP_505176.2 Frag1 26..234 CDD:370945 28/135 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3979
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12892
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.