DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15880 and pgap-2

DIOPT Version :9

Sequence 1:NP_608547.2 Gene:CG15880 / 33257 FlyBaseID:FBgn0031283 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001369853.1 Gene:pgap-2 / 188041 WormBaseID:WBGene00007045 Length:263 Species:Caenorhabditis elegans


Alignment Length:248 Identity:58/248 - (23%)
Similarity:103/248 - (41%) Gaps:48/248 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RHFRIPVGPILALGLLQLPVCMVYNLVMAITTDFQSTTYTTCNAFNIFPSTSAAAKS---QHKVW 84
            ::|.|.:|.:.:..||   :|::.:|::    .|...|.|.|...|..||.|||..:   :..:|
 Worm    14 KYFVICIGGLPSSALL---ICVILSLLL----HFDQATSTHCEVANWLPSISAAVSTYTPEKYIW 71

  Fly    85 ALACYLEF-PFLIASAWLQFR-FYRRNLRRPVRG-----FGCLMAIIMAVSSSSVLLWGTFPQED 142
            .:...|.. |.|:.:  :.|| |...:..||:.|     |.|.:|..:.:..:..||..|.....
 Worm    72 RILIGLHIGPRLVVA--IAFRNFLLGSPLRPLTGHKRLRFLCNLACFLNLLENFFLLALTSISSS 134

  Fly   143 GDSLLHITIALSLFVSCAIYMAGSFVCAKYYM--------------SDRIGQLHEEFSLRLKSGL 193
            .|..||        ..|   ..|..:|:..||              :..:||...|:.:...:..
 Worm   135 EDHSLH--------AKC---FGGFAICSIIYMLLSTWLFNETGRRTATNLGQRSHEYKILGAAIF 188

  Fly   194 VLTYYVWVVVMWIFYFIHQKFCFPLAYSVFGMGEFISCECFFIYLCTVYFDFY 246
            ||.:::...:.|    .|..:|.|..|::|.:.|:.:......:.||:|:||:
 Worm   189 VLCFFLGAYLYW----RHNTYCEPGIYTLFALVEYSAVLSNIFFHCTLYYDFH 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15880NP_608547.2 Frag1 32..247 CDD:287278 55/239 (23%)
pgap-2NP_001369853.1 Frag1 12..239 CDD:402067 58/248 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3979
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12892
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.