DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15880 and F36H9.5

DIOPT Version :9

Sequence 1:NP_608547.2 Gene:CG15880 / 33257 FlyBaseID:FBgn0031283 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_503503.1 Gene:F36H9.5 / 185391 WormBaseID:WBGene00018113 Length:352 Species:Caenorhabditis elegans


Alignment Length:243 Identity:47/243 - (19%)
Similarity:79/243 - (32%) Gaps:98/243 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 YLEFPFLIASAWLQFRFYRRNLRRPVRGFGCLMAIIMAVSS------------SSVLLW------ 135
            ||:||.|.||  |.|.|.      .|..|  :.|::.|:.:            :|:::|      
 Worm    53 YLDFPLLRAS--LIFTFI------SVTAF--VAAVLAALPTNYTPLLDEELVDNSIIIWYGAKVY 107

  Fly   136 -----GTFPQEDGDSLLH-----------------ITIALSLFVS-------------------- 158
                 .|:|::...|:|:                 :|||:..|.|                    
 Worm   108 RCRTFFTYPKDGLLSILNLLELNVWGNVIFRLATCLTIAVRFFQSIVFRNLLINGFWREVPNPMF 172

  Fly   159 ---CAIYMAGSFVCAKYYMSDRIGQLHEEF---SLRLKSGLVLTYYVWVVVMWIFYFIHQKFCFP 217
               |.:....:.:.........|..:|.:|   :...||...:...|.:.:..||:|:       
 Worm   173 RWLCDLLPMLTLIETTALAMFSIITMHSDFKEINHFCKSTFAIVSVVNMCIPTIFHFV------- 230

  Fly   218 LAYSVFGMGE----FIS--CECFFIYLCTVYFDFY---------HVYI 250
            |:.:.....|    |:.  |...|.|....||.|:         |.||
 Worm   231 LSINSSKKAEASIVFVRAVCAVVFGYCAPQYFQFHIGWTKESLCHSYI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15880NP_608547.2 Frag1 32..247 CDD:287278 44/238 (18%)
F36H9.5NP_503503.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12892
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.