powered by:
Protein Alignment CG15880 and C14B9.3
DIOPT Version :9
Sequence 1: | NP_608547.2 |
Gene: | CG15880 / 33257 |
FlyBaseID: | FBgn0031283 |
Length: | 263 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_498771.1 |
Gene: | C14B9.3 / 176144 |
WormBaseID: | WBGene00015753 |
Length: | 348 |
Species: | Caenorhabditis elegans |
Alignment Length: | 127 |
Identity: | 26/127 - (20%) |
Similarity: | 43/127 - (33%) |
Gaps: | 49/127 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 123 IIMAVSSSSVLLWGTFPQEDGDSLLHITIALSLFV-----------------SCAIYMAGSFVCA 170
::.|.||:|...|.|. |::...|::.::| .|..||...|...
Worm 225 VMFAFSSNSESKWDTV------SMIMKLISVVIYVYLMPQYMQYHQSSITFPICHSYMPQLFALM 283
Fly 171 KYYMSDRIGQLHEEFSLRLKSGLVLTYYVWVVVMWIFYFIHQKFCFPLAYSVFGMGEFISCE 232
:|::.......|..|.:.::: ..|| |||.:.| || ||
Worm 284 EYFIIIAYATFHLSFLIDIRN---------------ISFI----CFPRSSS----GE---CE 319
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG15880 | NP_608547.2 |
Frag1 |
32..247 |
CDD:287278 |
26/127 (20%) |
C14B9.3 | NP_498771.1 |
Frag1 |
<179..305 |
CDD:287278 |
16/100 (16%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR12892 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.