DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15880 and C14B9.3

DIOPT Version :9

Sequence 1:NP_608547.2 Gene:CG15880 / 33257 FlyBaseID:FBgn0031283 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_498771.1 Gene:C14B9.3 / 176144 WormBaseID:WBGene00015753 Length:348 Species:Caenorhabditis elegans


Alignment Length:127 Identity:26/127 - (20%)
Similarity:43/127 - (33%) Gaps:49/127 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 IIMAVSSSSVLLWGTFPQEDGDSLLHITIALSLFV-----------------SCAIYMAGSFVCA 170
            ::.|.||:|...|.|.      |::...|::.::|                 .|..||...|...
 Worm   225 VMFAFSSNSESKWDTV------SMIMKLISVVIYVYLMPQYMQYHQSSITFPICHSYMPQLFALM 283

  Fly   171 KYYMSDRIGQLHEEFSLRLKSGLVLTYYVWVVVMWIFYFIHQKFCFPLAYSVFGMGEFISCE 232
            :|::.......|..|.:.:::               ..||    |||.:.|    ||   ||
 Worm   284 EYFIIIAYATFHLSFLIDIRN---------------ISFI----CFPRSSS----GE---CE 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15880NP_608547.2 Frag1 32..247 CDD:287278 26/127 (20%)
C14B9.3NP_498771.1 Frag1 <179..305 CDD:287278 16/100 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12892
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.