DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15880 and Pgap2

DIOPT Version :9

Sequence 1:NP_608547.2 Gene:CG15880 / 33257 FlyBaseID:FBgn0031283 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_006229887.1 Gene:Pgap2 / 116675 RGDID:619744 Length:339 Species:Rattus norvegicus


Alignment Length:154 Identity:36/154 - (23%)
Similarity:59/154 - (38%) Gaps:18/154 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RRHFRIPVGPILALGLLQLPVCMVYNLVMAITTDFQSTTYTTCNAFNIFPSTSAAAKS---QHKV 83
            |..|...|..::...|.....|::::||.    .|:.|..|.|...|..||.|:|...   |..|
  Rat    89 RLRFTAFVWWVITFPLFGFFFCIIWSLVF----HFEYTVATDCGVPNYLPSVSSAIGGEVPQRYV 149

  Fly    84 WALACYLEFPFLIASAWLQFRFYRRNLRRPVRGFG--CLMAIIMAVSSSSVLLWGTFPQEDGDSL 146
            |.....|.......:|:..:..| .:...|..|:.  |.:...:.|..:..||..|:.....|..
  Rat   150 WRFCIGLHSAPRFLTAFAYWNHY-LSCASPCPGYRLLCRLNFSLNVVENLALLVLTYVSSSEDFT 213

  Fly   147 LH-----ITIALSL---FVSCAIY 162
            :|     :.||.||   .::|.::
  Rat   214 IHENAFIVFIAASLSYMLLTCILW 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15880NP_608547.2 Frag1 32..247 CDD:287278 33/144 (23%)
Pgap2XP_006229887.1 Frag1 102..>253 CDD:402067 33/141 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341323
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12892
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.