DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex12 and PEX12

DIOPT Version :9

Sequence 1:NP_001259844.1 Gene:Pex12 / 33256 FlyBaseID:FBgn0031282 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_000277.1 Gene:PEX12 / 5193 HGNCID:8854 Length:359 Species:Homo sapiens


Alignment Length:380 Identity:107/380 - (28%)
Similarity:168/380 - (44%) Gaps:110/380 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAE------AANVRQNLQNVPSIFEISASETLDNLIYPALSKIF--------DYFGLRLDFKLWG 51
            |||      ||:|   ..:.|||||:.|.::|...:.|||..:.        .::|.     || 
Human     1 MAEHGAHFTAASV---ADDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPTHYGF-----LW- 56

  Fly    52 SLRIQEELSPLLTWLLQYLYLRKRASSFGESFYGLQRTVTTTGDLLNRRQQFASATL-------- 108
              |..:|:..||..|||..||.:.::||.|:||||:|.|  .|| .::.|:.|||.|        
Human    57 --RWFDEIFTLLDLLLQQHYLSRTSASFSENFYGLKRIV--MGD-THKSQRLASAGLPKQQLWKS 116

  Fly   109 ---LTFMPYVERKLRTRIT--RHED-------TSPWEQRLLSAFHAFHAAKAAHTFF-------- 153
               |..:||::.||...::  |.||       :|.|::       .:.|..||:.|.        
Human   117 IMFLVLLPYLKVKLEKLVSSLREEDEYSIHPPSSRWKR-------FYRAFLAAYPFVNMAWEGWF 174

  Fly   154 ------YLVKYASNHSPIFRLLGLTL---------RYPSEPPKEDQWTY---------------- 187
                  |::..|.:|||:.||.|:.|         ....:|.|......                
Human   175 LVQQLRYILGKAQHHSPLLRLAGVQLGRLTVQDIQALEHKPAKASMMQQPARSVSEKINSALKKA 239

  Fly   188 ---VVLKM---LEVLAFFLQFVQWWYSNDQRRKVGGTLINPEAMPRKQLPKEVQQS-----LPQ- 240
               |.|.:   |.|..|||||:.||||::.:.    |:.:..|:|....|..:..:     ||: 
Human   240 VGGVALSLSTGLSVGVFFLQFLDWWYSSENQE----TIKSLTALPTPPPPVHLDYNSDSPLLPKM 300

  Fly   241 RGECPVCLLSIQTPTACSVSGYVFCWKCIVSHMKEHGTCPVTHYPISLDDLVRIY 295
            :..||:|..:....|..:.||||||::|:..:::.|..||:|.||..:..|:::|
Human   301 KTVCPLCRKTRVNDTVLATSGYVFCYRCVFHYVRSHQACPITGYPTEVQHLIKLY 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex12NP_001259844.1 Pex2_Pex12 24..209 CDD:282595 69/257 (27%)
zf-RING_2 242..281 CDD:290367 13/38 (34%)
PEX12NP_000277.1 Pex2_Pex12 26..267 CDD:282595 69/258 (27%)
RING 304..341 CDD:214546 13/36 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143585
Domainoid 1 1.000 59 1.000 Domainoid score I10745
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H240
Inparanoid 1 1.050 118 1.000 Inparanoid score I4805
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55389
OrthoDB 1 1.010 - - D1204472at2759
OrthoFinder 1 1.000 - - FOG0005079
OrthoInspector 1 1.000 - - oto90835
orthoMCL 1 0.900 - - OOG6_103569
Panther 1 1.100 - - LDO PTHR12888
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R900
SonicParanoid 1 1.000 - - X5424
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.900

Return to query results.
Submit another query.