DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex12 and SPAPB17E12.03

DIOPT Version :9

Sequence 1:NP_001259844.1 Gene:Pex12 / 33256 FlyBaseID:FBgn0031282 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001342998.1 Gene:SPAPB17E12.03 / 3361409 PomBaseID:SPAPB17E12.03 Length:343 Species:Schizosaccharomyces pombe


Alignment Length:334 Identity:77/334 - (23%)
Similarity:127/334 - (38%) Gaps:66/334 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PSIFEISASETLDNLIYPALSKIFDYFGLRLDFKLWGSLRIQEELSPLLTWLLQYLYLRKRASSF 79
            ||:.|:...:.::.||.|:|..|..||..|....|..:....:.:..|:..||:...|:|..::.
pombe     4 PSLLEVLQVQQVEKLISPSLRFILAYFTHRYPRFLLRAYNSFDGIYLLVKLLLEKSQLKKWNATS 68

  Fly    80 GESFYGLQRTVTTTGDLLNRR---QQFASAT-----------LLTF-MPYVERKLRTRITRHED- 128
            .|..:.|:|.:......:...   |:..|||           .||: :||:..|..:..|..|: 
pombe    69 VERRFQLKRVIAVRDSSIIAEEFPQESESATSLNGIDVLKKLFLTYCIPYLLEKCESLTTVKENH 133

  Fly   129 ---------TSPWEQRLLSAFHA----------------FHAAKAAHTF---FYLVKYASNHSPI 165
                     ....::..||.|::                |...:.::|:   .|.:.||...:|.
pombe   134 TAVSILSLQARDKQKGALSVFYSKIKILLVRLKKILHFVFRLIRKSNTYLQWLYYLLYALGKTPY 198

  Fly   166 FRLLGLTLRYP--------------SEPPKEDQWTYVVLKMLEVLAFFLQFVQWWYSN--DQRRK 214
            ..|....||..              |...|....|.:....:|.....:|.:.||.||  :...|
pombe   199 TNLADHILRQRVIYNVENIHSRKLISTREKSSLLTSIADHSMEGFLIIIQLIDWWQSNNYESHLK 263

  Fly   215 VGGTLINPEAMPRKQLPKEVQQSLPQRGECPVCLLSIQTPTACSVSGYVFCWKCIVSHMKEHG-T 278
            .|.......|.|:  ||.|:..|...  .|.:|...|:.|...| :|:|||:.||...::.|. .
pombe   264 KGEVAFTELAPPK--LPFEINVSTTD--ICKICGEKIKNPAVLS-TGFVFCYPCIQVWLQRHPFK 323

  Fly   279 CPVTHYPIS 287
            ||||:..:|
pombe   324 CPVTNLELS 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex12NP_001259844.1 Pex2_Pex12 24..209 CDD:282595 47/242 (19%)
zf-RING_2 242..281 CDD:290367 13/39 (33%)
SPAPB17E12.03NP_001342998.1 Pex2_Pex12 13..256 CDD:309754 47/242 (19%)
mRING_PEX12 289..329 CDD:319365 16/40 (40%)
modified RING finger 289..327 CDD:319365 14/38 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0826
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H240
Inparanoid 1 1.050 54 1.000 Inparanoid score I2041
OMA 1 1.010 - - QHG55389
OrthoFinder 1 1.000 - - FOG0005079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103569
Panther 1 1.100 - - LDO PTHR12888
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R900
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.860

Return to query results.
Submit another query.