DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex12 and Pex12

DIOPT Version :9

Sequence 1:NP_001259844.1 Gene:Pex12 / 33256 FlyBaseID:FBgn0031282 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001351691.1 Gene:Pex12 / 103737 MGIID:2144177 Length:359 Species:Mus musculus


Alignment Length:359 Identity:96/359 - (26%)
Similarity:148/359 - (41%) Gaps:99/359 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PSIFEISASETLDNLIYPALSKIFD--------YFGLRLDFKLWGSLRIQEELSPLLTWLLQYLY 71
            |||||:.|.::|...:.|||..:..        ::|.     ||   |..:|:..||.:|||..|
Mouse    18 PSIFEVVAQDSLMTAVRPALQHVVKVLAESNPAHYGF-----LW---RWFDEIFTLLDFLLQQHY 74

  Fly    72 LRKRASSFGESFYGLQRTVTTTGDLLNR--------RQQFASATLLTFMPYVERKLRTRIT--RH 126
            |.:.::||.|.||||:|.|..:...|.|        ...:.||..|..:||::.||....:  |.
Mouse    75 LSRTSASFSEHFYGLKRIVAGSSPHLQRPASAGLPKEHLWKSAMFLVLLPYLKVKLEKLASSLRE 139

  Fly   127 ED-------TSPWEQRLLSAFHAFHAAKAAHTFF--------------YLVKYASNHSPIFRLLG 170
            ||       :|.|::       .:.|..||:.|.              |::..|.:|||:.:|.|
Mouse   140 EDEYSIHPPSSRWKR-------FYRAFLAAYPFVNMAWEGWFLTQQLRYILGKAEHHSPLLKLAG 197

  Fly   171 LTL-------------------------RYPSEPPKEDQWTYVVLKM------------LEVLAF 198
            :.|                         |...|..|.      .||.            |.|..|
Mouse   198 VRLARLTAQDMQAIKQRLVEASAMQEPVRSVGEKIKS------ALKKAVGGVALSLSTGLSVGVF 256

  Fly   199 FLQFVQWWYSNDQRRKVGGTLINPEAMPRKQLPKEVQQSL--PQRGECPVCLLSIQTPTACSVSG 261
            ||||:.||||::.:..:......|...|...|.......|  ..:..||:|..:....|..:.||
Mouse   257 FLQFLDWWYSSENQEAIKSLTALPTPPPPVHLDYNSDSPLLPKMKTVCPLCRKTRVNDTVLATSG 321

  Fly   262 YVFCWKCIVSHMKEHGTCPVTHYPISLDDLVRIY 295
            ||||::|:.::::.|..||:|.||..:..|:::|
Mouse   322 YVFCYRCVFNYVRSHQACPITGYPTEVQHLIKLY 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex12NP_001259844.1 Pex2_Pex12 24..209 CDD:282595 66/260 (25%)
zf-RING_2 242..281 CDD:290367 13/38 (34%)
Pex12NP_001351691.1 Pex2_Pex12 26..267 CDD:368100 78/318 (25%)
mRING_PEX12 304..345 CDD:319365
modified RING finger 304..342 CDD:319365


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833740
Domainoid 1 1.000 58 1.000 Domainoid score I10796
eggNOG 1 0.900 - - E1_KOG0826
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H240
Inparanoid 1 1.050 115 1.000 Inparanoid score I4813
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55389
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005079
OrthoInspector 1 1.000 - - oto94418
orthoMCL 1 0.900 - - OOG6_103569
Panther 1 1.100 - - LDO PTHR12888
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R900
SonicParanoid 1 1.000 - - X5424
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.