DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pex12 and pex12

DIOPT Version :9

Sequence 1:NP_001259844.1 Gene:Pex12 / 33256 FlyBaseID:FBgn0031282 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_002933865.1 Gene:pex12 / 100380099 XenbaseID:XB-GENE-1014986 Length:353 Species:Xenopus tropicalis


Alignment Length:340 Identity:104/340 - (30%)
Similarity:150/340 - (44%) Gaps:67/340 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PSIFEISASETLDNLIYPALSKIFDY--------FGLRLDFKLWGSLRIQEELSPLLTWLLQYLY 71
            |||||:.|.|:|...:.|||..|...        :|     .||   |..:||..||.||||...
 Frog    18 PSIFEVVAQESLMAAVRPALHHIVKVLAESNPARYG-----TLW---RWFDELYTLLDWLLQQHS 74

  Fly    72 LRKRASSFGESFYGLQR-TVTTTGDLLN--RRQQFASATLLTFMPYVERKLRTRITRHEDTSPWE 133
            |...::||.|:||||:| |:...|...|  |::.:.|..||..:||:..||...::|..:...:.
 Frog    75 LSWASASFSENFYGLKRVTLGRKGGQQNLPRKEYWKSLLLLVLVPYLRIKLEKLVSRLREEEDYS 139

  Fly   134 QRLLSAFH--AFHAAKAAHTF----------FYLVKY----ASNHSPIFRLLG-----LTLRYPS 177
            .:..::||  .:.|..|::.|          ||.:||    ..:|||:..|.|     ||:....
 Frog   140 IQNPTSFHKRCYKAILASYPFVKLGWEAWFLFYQLKYILGNGKHHSPLLGLAGVQLNRLTMEDLR 204

  Fly   178 EPPKEDQWTYVV-------------LK------------MLEVLAFFLQFVQWWYSNDQRRKVGG 217
            ...|:.:.|..|             ||            .|.:..|||||:.||||.:.:..:..
 Frog   205 AMEKQQEMTNTVSNAVSISHRIRDILKKALGAVALSVSSSLSLGVFFLQFLDWWYSAENQETLKS 269

  Fly   218 TLINPEAMPRKQLPKEVQQS-LPQ-RGECPVCLLSIQTPTACSVSGYVFCWKCIVSHMKEHGTCP 280
            ....|...|......|.... ||: |..||:|.......||...||||||::|...::|.|..||
 Frog   270 LSNLPVPPPPIHFDLETYSPLLPKLRTVCPLCRKVRVNDTALGTSGYVFCYRCAYYYVKTHQRCP 334

  Fly   281 VTHYPISLDDLVRIY 295
            |:.||..|..|:::|
 Frog   335 VSGYPTELQHLIKLY 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pex12NP_001259844.1 Pex2_Pex12 24..209 CDD:282595 69/241 (29%)
zf-RING_2 242..281 CDD:290367 15/38 (39%)
pex12XP_002933865.1 Pex2_Pex12 26..260 CDD:368100 68/241 (28%)
mRING_PEX12 298..339 CDD:319365 17/40 (43%)
modified RING finger 298..336 CDD:319365 16/37 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9825
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H240
Inparanoid 1 1.050 122 1.000 Inparanoid score I4601
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1204472at2759
OrthoFinder 1 1.000 - - FOG0005079
OrthoInspector 1 1.000 - - oto104626
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5424
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.