DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Saf6 and taf6

DIOPT Version :9

Sequence 1:NP_608545.1 Gene:Saf6 / 33255 FlyBaseID:FBgn0031281 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_587928.1 Gene:taf6 / 2539133 PomBaseID:SPCC16C4.18c Length:452 Species:Schizosaccharomyces pombe


Alignment Length:118 Identity:24/118 - (20%)
Similarity:48/118 - (40%) Gaps:22/118 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 WEQHDQTDV-------ELSQDVCARLAEDASYKVWELINNVKIYSRHS-GGVVTYDLVNEVLKDA 193
            |......||       .|:.:..|.:|.|..|::.:::.....:..|| ..|:|...::..|:..
pombe     6 WNIESIKDVAEMLGIGNLADEPAAAIAMDLEYRIHQVVQEATKFMVHSKRTVLTSADISSALRTL 70

  Fly   194 DVPPMLGAMDSDWDRIDY--------DGSFYFHSDKIFELSAEFQKEVNLCTP 238
            :|.|:.|..:|  ..:::        ..|.|:..|:    ..:|:|.:|...|
pombe    71 NVEPLYGFNNS--RPLEFHEAAVGAGQNSLYYLDDE----EVDFEKIINAPLP 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Saf6NP_608545.1 None
taf6NP_587928.1 TAF6 1..452 CDD:227426 24/118 (20%)
TAF6 9..363 CDD:173968 23/115 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10221
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.