DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Saf6 and taf6l

DIOPT Version :9

Sequence 1:NP_608545.1 Gene:Saf6 / 33255 FlyBaseID:FBgn0031281 Length:717 Species:Drosophila melanogaster
Sequence 2:XP_002933255.1 Gene:taf6l / 100486266 XenbaseID:XB-GENE-1000128 Length:574 Species:Xenopus tropicalis


Alignment Length:241 Identity:53/241 - (21%)
Similarity:86/241 - (35%) Gaps:61/241 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 MGH--QKSYAGFDPRSIKIFWEQHDQTDVELSQDVCARLAEDASYKVWELINNVKIYSRHS-GGV 180
            |.|  .:.|......|:::..|   ...::::.:|.|.||||..|::.||........||| ...
 Frog     1 MSHTEDRRYVELCQDSVRLTAE---SVGLDITDEVAALLAEDVCYRLRELTQFSAQCLRHSRRRR 62

  Fly   181 VTYDLVNEVLKDADVPPML--GAMDSDWDRIDYDGSFYFHSDKIFELSAEFQKEVNLC------- 236
            :|.:..|..|:.::|..:.  |:.||...|...||..::..|          :|:||.       
 Frog    63 LTVEDFNRALRWSNVEAVCGHGSPDSVTYRSIKDGDCHYTED----------REINLVELALATN 117

  Fly   237 ----TPDDADFQSICPVEDK----HMDQLRQCVQSL----------VTAALFADSKSQTAAVCHA 283
                ||:.|....:..::.|    |...:...|..|          ||.|:..|...........
 Frog   118 IPKGTPETAVRVHVSYLDGKGNLEHQGTVPAAVSLLTDDLLKYYQRVTRAVLGDDPHLMKVALQD 182

  Fly   284 FQTPLMGSIYRVIVSKMVQLLAF--------KQQDHLSQRCWRLLR 321
            .||.          ||:..||.:        |...|..::..|||:
 Frog   183 LQTN----------SKIAALLPYFVYVVSGVKSVSHDLEQLSRLLQ 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Saf6NP_608545.1 None
taf6lXP_002933255.1 TAF 10..73 CDD:129039 16/65 (25%)
TAF6C 151..364 CDD:381749 16/78 (21%)
HEAT repeat 155..186 CDD:381749 5/30 (17%)
HEAT repeat 193..225 CDD:381749 6/26 (23%)
HEAT repeat 235..277 CDD:381749
HEAT repeat 284..316 CDD:381749
HEAT repeat 318..363 CDD:381749
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10221
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.