DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dbp21E2 and ddx28

DIOPT Version :10

Sequence 1:NP_608544.1 Gene:Dbp21E2 / 33254 FlyBaseID:FBgn0086130 Length:536 Species:Drosophila melanogaster
Sequence 2:XP_002941020.2 Gene:ddx28 / 100487122 XenbaseID:XB-GENE-969500 Length:522 Species:Xenopus tropicalis


Alignment Length:42 Identity:11/42 - (26%)
Similarity:21/42 - (50%) Gaps:13/42 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 VSVPSLELD--VRMNCIS---SMDVD--------SISPNITK 284
            :.|...|.|  :.::|:|   |:.::        :|||.|:|
 Frog    42 IMVIQTETDRHITLHCLSVNGSLPINYTFFENHVAISPAISK 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dbp21E2NP_608544.1 DEADc_DDX28 119..345 CDD:350706 11/42 (26%)
SF2_C_DEAD 339..462 CDD:350174
ddx28XP_002941020.2 SrmB 116..503 CDD:440279
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.