DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkg21D and Cnbd2

DIOPT Version :9

Sequence 1:NP_477213.1 Gene:Pkg21D / 33253 FlyBaseID:FBgn0000442 Length:768 Species:Drosophila melanogaster
Sequence 2:NP_081861.2 Gene:Cnbd2 / 70873 MGIID:1918123 Length:673 Species:Mus musculus


Alignment Length:385 Identity:90/385 - (23%)
Similarity:146/385 - (37%) Gaps:107/385 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 SRNQNPHLCSSCGMV---LPTSPEFALEALSLG-----PLSPL---ASTSSASPSGRTSADEVRP 134
            :|:.||...||...|   |..|.:.:......|     ||.|.   .:|.|.|.||..|..| ..
Mouse     2 NRSANPEAASSTSHVKFDLGKSVDISSTDTKDGGTARSPLEPADKSDTTESKSESGSDSRSE-ED 65

  Fly   135 KAMPAAIKKQGVSAESCVQSMQQSYSIPIPKYEKDFSDKQQIKDAIMDNDFLKNIDASQVREL-- 197
            |..||:||:  :.||:           |.||      |:..::..:..:..:|:..|.:.|:|  
Mouse    66 KESPASIKE--IKAET-----------PQPK------DRPGVQIKLSWSQKIKSWTAKKKRKLYQ 111

  Fly   198 --VDSMYSKSIAAGEFVIREGEVGAHLY-----------------------VSAAGEFAVMQQGK 237
              :|.:....:..   :.|:|..|...|                       :|...|....|:|.
Mouse   112 LVIDIIMMNRVCK---MFRQGLRGFREYQIIEPVHKKHPDFSFWDKKKQGRISFVTEDFAAQEGH 173

  Fly   238 VLDKMGAGKAFGELAILYNCTRTASIRVLSEAARVWVLDRRVFQQIM-MCTGLQRIENSVNFLRS 301
                      |...||           .:::....|    |..|:|. :|..||.::...::..|
Mouse   174 ----------FPPRAI-----------SITQKKPSW----RTHQEIQDLCNILQALDCYRSYTES 213

  Fly   302 VPLLMNLSEELLAKIADVLELEFYAAGTYIIRQGTAGDSFFLISQGNVRVTQKLTPTS----PEE 362
            :.||          :|.|:..|.:.....|:::|..|:||:.|..|.|.:|:....:|    |..
Mouse   214 LQLL----------LAKVIRFERFGRRRVIVKKGQMGNSFYFIYLGTVAITEDEDGSSAFLDPHP 268

  Fly   363 TELRTLSRGDYFGEQALINEDKRTANIIALSPGVECLTLDRDSF-KRLIGDLCELKEKDY 421
            |   .|.||..|||..|::...|:|.::.:.. .|.|.:||:.| ...:||..: ||..|
Mouse   269 T---LLHRGGSFGEMGLLSTTVRSATVVCMEE-TEFLVVDREDFVANKLGDEVQ-KETQY 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkg21DNP_477213.1 Crp 183..386 CDD:223736 48/234 (21%)
CAP_ED 185..285 CDD:237999 20/127 (16%)
CAP_ED 304..419 CDD:237999 34/119 (29%)
Pkinase 457..717 CDD:278497
STKc_cGK 463..724 CDD:270724
S_TK_X 719..>760 CDD:214529
Cnbd2NP_081861.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89 30/106 (28%)
Crp 200..>353 CDD:223736 39/139 (28%)
CAP_ED 211..308 CDD:237999 31/110 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0664
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.