DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkg21D and PRKX

DIOPT Version :9

Sequence 1:NP_477213.1 Gene:Pkg21D / 33253 FlyBaseID:FBgn0000442 Length:768 Species:Drosophila melanogaster
Sequence 2:NP_005035.1 Gene:PRKX / 5613 HGNCID:9441 Length:358 Species:Homo sapiens


Alignment Length:336 Identity:143/336 - (42%)
Similarity:202/336 - (60%) Gaps:21/336 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   424 ESRKLAMKQAQESCRDEP-----KEQLQQEFPDLKLTDLEVVSTLGIGGFGRVELVK---AHHQD 480
            :|||:    |:|:....|     .|.|..|.|...|.|.:.::|:|.|.||||.|||   |.|  
Human    15 DSRKV----AEETPDGAPALCPSPEALSPEPPVYSLQDFDTLATVGTGTFGRVHLVKEKTAKH-- 73

  Fly   481 RVDIFALKCLKKRHIVDTKQEEHIFSERHIMLSSRSPFICRLYRTFRDEKYVYMLLEACMGGEIW 545
               .||||.:....::..|||:|:.:|:.::.....||:.||:.|:.||:::|||:|...|||::
Human    74 ---FFALKVMSIPDVIRLKQEQHVHNEKSVLKEVSHPFLIRLFWTWHDERFLYMLMEYVPGGELF 135

  Fly   546 TMLRDRGSFEDNAAQFIIGCVLQAFEYLHARGIIYRDLKPENLMLDERGYVKIVDFGFAKQIGTS 610
            :.||:||.|......|....::.|.||||::.|:||||||||::||..|::|:.||||||::  .
Human   136 SYLRNRGRFSSTTGLFYSAEIICAIEYLHSKEIVYRDLKPENILLDRDGHIKLTDFGFAKKL--V 198

  Fly   611 SKTWTFCGTPEYVAPEIILNKGHDRAVDYWALGILIHELLNGTPPFSAPDPMQTYNLILKGIDMI 675
            .:|||.||||||:|||:|.:|||.||||:|||||||.|:|:|.|||...:|...|..||.|  .|
Human   199 DRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKILAG--KI 261

  Fly   676 AFPKHISRWAVQLIKRLCRDVPSERLGYQTGGIQDIKKHKWFLGFDWDGLASQLLIPPFVRPIAH 740
            .||:|:......|||:|.....:.|||....|..|:|.|:||...||:.:..:.|.||.|..||.
Human   262 DFPRHLDFHVKDLIKKLLVVDRTRRLGNMKNGANDVKHHRWFRSVDWEAVPQRKLKPPIVPKIAG 326

  Fly   741 PTDVRYFDRFP 751
            ..|...|:.:|
Human   327 DGDTSNFETYP 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkg21DNP_477213.1 Crp 183..386 CDD:223736
CAP_ED 185..285 CDD:237999
CAP_ED 304..419 CDD:237999
Pkinase 457..717 CDD:278497 118/262 (45%)
STKc_cGK 463..724 CDD:270724 121/263 (46%)
S_TK_X 719..>760 CDD:214529 11/33 (33%)
PRKXNP_005035.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34 6/22 (27%)
PTZ00263 39..358 CDD:140289 135/308 (44%)
STKc_PRKX_like 47..338 CDD:270763 132/300 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.