DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkg21D and PRKAR2B

DIOPT Version :9

Sequence 1:NP_477213.1 Gene:Pkg21D / 33253 FlyBaseID:FBgn0000442 Length:768 Species:Drosophila melanogaster
Sequence 2:NP_002727.2 Gene:PRKAR2B / 5577 HGNCID:9392 Length:418 Species:Homo sapiens


Alignment Length:364 Identity:106/364 - (29%)
Similarity:173/364 - (47%) Gaps:48/364 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 FALEALSLGPLSPLASTSSAS--------PSGRTSADEVRPKAMPA--------AIKKQGVSAES 150
            |..|..:.|.|...|...:.|        |....|.|....:|.||        .|.:....|..
Human    51 FGHEGRTWGDLGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASV 115

  Fly   151 CVQSMQQSYSIPIPKYEKDFSD-----------KQQIKDAIMDNDFLKNIDASQVRELVDSMYSK 204
            |.::..       |..|:|.::           :.::::|..|....||:|..|:.:::|:|:.|
Human   116 CAEAYN-------PDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEK 173

  Fly   205 SIAAGEFVIREGEVGAHLYVSAAGEFAVMQQ----GKVLDKMGAGKAFGELAILYNCTRTASIRV 265
            .:..||.||.:|:.|.:.||...|.|.:..:    |:.:.......:|||||::||..|.|:|..
Human   174 LVKDGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITA 238

  Fly   266 LSEAARVWVLDRRVFQQIMMCTGLQRIENSVNFLRSVPLLMNL--SEELLAKIADVLELEFYAAG 328
            .|..| :|.|||..|::|::....::.:...:|:.|:|.|.:|  ||.|  |:.||:..:.|..|
Human   239 TSPGA-LWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEFSERL--KVVDVIGTKVYNDG 300

  Fly   329 TYIIRQGTAGDSFFLISQGNVRVTQKLTPTSPEE----TELRTLSRGDYFGEQALINEDKRTANI 389
            ..||.||.:.||||::..|.|::|.|....|..|    .|:...|||.||||.||:....|.|:.
Human   301 EQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKPRAASA 365

  Fly   390 IALSPGVECLTLDRDSFKRLIGDLCELKEKDYGDESRKL 428
            .|:.. |:||.:|..:|:||:|...|:.:::......:|
Human   366 HAIGT-VKCLAMDVQAFERLLGPCMEIMKRNIATYEEQL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkg21DNP_477213.1 Crp 183..386 CDD:223736 73/212 (34%)
CAP_ED 185..285 CDD:237999 36/103 (35%)
CAP_ED 304..419 CDD:237999 46/120 (38%)
Pkinase 457..717 CDD:278497
STKc_cGK 463..724 CDD:270724
S_TK_X 719..>760 CDD:214529
PRKAR2BNP_002727.2 Dimerization and phosphorylation 2..153 20/108 (19%)
DD_RIIbeta_PKA 3..43 CDD:213051
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..96 10/44 (23%)
Crp 150..>259 CDD:223736 37/109 (34%)
CAP_ED 154..267 CDD:237999 36/113 (32%)
Crp 270..>385 CDD:223736 46/117 (39%)
CAP_ED 276..396 CDD:237999 46/122 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0664
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.