DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkg21D and PRKAR2A

DIOPT Version :9

Sequence 1:NP_477213.1 Gene:Pkg21D / 33253 FlyBaseID:FBgn0000442 Length:768 Species:Drosophila melanogaster
Sequence 2:NP_001308911.1 Gene:PRKAR2A / 5576 HGNCID:9391 Length:404 Species:Homo sapiens


Alignment Length:370 Identity:101/370 - (27%)
Similarity:176/370 - (47%) Gaps:45/370 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 PTSPEFALEALS--LGPLSPLASTSSASPSGRTSADEVRPKAMPAAIKKQGVSAESCVQSMQQSY 159
            |...|||:|..:  ....:|.:...:|:|  |.|.....|:..|..:......:||   ...:..
Human    27 PDLVEFAVEYFTRLREARAPASVLPAATP--RQSLGHPPPEPGPDRVADAKGDSES---EEDEDL 86

  Fly   160 SIPIPK------------YEKD-------------FSDKQ--QIKDAIMDNDFLKNIDASQVREL 197
            .:|:|.            |..|             .:|:|  ::::|..|....||:|..|:.::
Human    87 EVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIHPKTDEQRCRLQEACKDILLFKNLDQEQLSQV 151

  Fly   198 VDSMYSKSIAAGEFVIREGEVGAHLYVSAAGEFAVM----QQGKVLDKMGAGKAFGELAILYNCT 258
            :|:|:.:.:.|.|.||.:|:.|.:.||...|.:.::    .|.:.:.:.....:|||||::||..
Human   152 LDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTP 216

  Fly   259 RTASIRVLSEAARVWVLDRRVFQQIMMCTGLQRIENSVNFLRSVPLLMNLSEELLAKIADVLELE 323
            |.|:|...||.: :|.|||..|::|::....::.:...:|:.|||||.:|......||.||:..:
Human   217 RAATIVATSEGS-LWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEK 280

  Fly   324 FYAAGTYIIRQGTAGDSFFLISQGNVRV-----TQKLTPTSPEETELRTLSRGDYFGEQALINED 383
            .|..|..||.||...|||::|..|.|.:     |:.......:|.|:....:|.||||.||:...
Human   281 IYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNK 345

  Fly   384 KRTANIIALSPGVECLTLDRDSFKRLIGDLCELKEKDYGDESRKL 428
            .|.|:..|:. .|:||.:|..:|:||:|...::.:::......:|
Human   346 PRAASAYAVG-DVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQL 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkg21DNP_477213.1 Crp 183..386 CDD:223736 67/211 (32%)
CAP_ED 185..285 CDD:237999 34/103 (33%)
CAP_ED 304..419 CDD:237999 40/119 (34%)
Pkinase 457..717 CDD:278497
STKc_cGK 463..724 CDD:270724
S_TK_X 719..>760 CDD:214529
PRKAR2ANP_001308911.1 Dimerization and phosphorylation 2..138 22/115 (19%)
DD_RIIalpha_PKA 4..44 CDD:213050 5/16 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..90 8/47 (17%)
Crp 135..>244 CDD:223736 35/109 (32%)
CAP_ED 139..251 CDD:237999 34/112 (30%)
Crp 255..>371 CDD:223736 42/116 (36%)
CAP_ED 261..382 CDD:237999 40/121 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0664
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.