DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkg21D and CG12069

DIOPT Version :9

Sequence 1:NP_477213.1 Gene:Pkg21D / 33253 FlyBaseID:FBgn0000442 Length:768 Species:Drosophila melanogaster
Sequence 2:NP_651819.1 Gene:CG12069 / 43643 FlyBaseID:FBgn0039796 Length:356 Species:Drosophila melanogaster


Alignment Length:319 Identity:122/319 - (38%)
Similarity:183/319 - (57%) Gaps:14/319 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   439 DEPKEQLQQEF------PDLKLTDLEVVSTLGIGGFGRVELVKAHHQDRVDIFALKCLKKRHIVD 497
            |:.:|...::|      |...|.|.|:.:|||.|.||:|:||:  .::....:|.|.|.|..||.
  Fly    23 DKLREDFNKKFATNTPSPSTGLDDYEIKATLGSGSFGKVQLVR--ERESGVYYASKQLSKDQIVK 85

  Fly   498 TKQEEHIFSERHIMLSSRSPFICRLYRTFRDEKYVYMLLEACMGGEIWTMLRDRGSFEDNAAQFI 562
            |||..|:.||::::.|...|....|..:::|...:|::|....|||::|..|....|.:..|:|.
  Fly    86 TKQVSHVMSEKNVLRSMTFPNTVNLIASYKDFDSLYLVLPLIGGGELFTYHRKVRKFTEKQARFY 150

  Fly   563 IGCVLQAFEYLHARGIIYRDLKPENLMLDERGYVKIVDFGFAKQIGTSSKTWTFCGTPEYVAPEI 627
            ...|..|.||||...::||||||||:|:|:.||:|:.||||||::.|  :|.|.||||||:.|||
  Fly   151 AAQVFLALEYLHHCSLLYRDLKPENIMMDKNGYLKVTDFGFAKKVET--RTMTLCGTPEYLPPEI 213

  Fly   628 ILNKGHDRAVDYWALGILIHELLNGTPPFSA--PDPMQTYNLILKGIDMIAFPKHISRWAVQLIK 690
            |.:|.:..:||:||.|:|:.|.:.|..||||  .|.|..||.|.:.  ....|.:.|.....|:.
  Fly   214 IQSKPYGTSVDWWAFGVLVFEFVAGHSPFSAHNRDVMSMYNKICEA--DYKMPSYFSGALRHLVD 276

  Fly   691 RLCRDVPSERLGYQTGGIQDIKKHKWFLGFDWDGLASQLLIPPFVRPIAHPTDVRYFDR 749
            .|.:...|:|.|....|.:|||:|:||...:|..|.:|.:..|:|..|::|.|:..||:
  Fly   277 HLLQVDLSKRFGNLINGNRDIKEHEWFKDVEWIPLLNQTVNAPYVPNISNPEDISNFDK 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkg21DNP_477213.1 Crp 183..386 CDD:223736
CAP_ED 185..285 CDD:237999
CAP_ED 304..419 CDD:237999
Pkinase 457..717 CDD:278497 104/261 (40%)
STKc_cGK 463..724 CDD:270724 105/262 (40%)
S_TK_X 719..>760 CDD:214529 10/31 (32%)
CG12069NP_651819.1 PTZ00263 44..356 CDD:140289 118/298 (40%)
PKc_like 45..335 CDD:304357 116/295 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440848
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24353
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.