DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkg21D and CG14693

DIOPT Version :9

Sequence 1:NP_477213.1 Gene:Pkg21D / 33253 FlyBaseID:FBgn0000442 Length:768 Species:Drosophila melanogaster
Sequence 2:NP_001262467.1 Gene:CG14693 / 41299 FlyBaseID:FBgn0037837 Length:586 Species:Drosophila melanogaster


Alignment Length:288 Identity:62/288 - (21%)
Similarity:108/288 - (37%) Gaps:61/288 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 TASIRVLSEAARVWVLDRRVFQQIMMCTGLQRIENSVNFLRSVPLLMNL-------------SEE 311
            :|.:|..|::..:...|:.:.:             :.:.:|::|..|.|             |.:
  Fly    52 SARVRTKSKSGFLTAADKSLIR-------------TPHVIRTIPERMKLCKLFAKLTCLAGFSPK 103

  Fly   312 LLAKIADVLELEFYAAGTYIIRQGTAGDSFFLISQGNVRVTQKLTPTSPEETELRTLSRGDYFGE 376
            :.|::..|:.|....||..||||..|..:.|.:..|.|.:.:.......|...:..|..||..|:
  Fly   104 IRARLVPVVRLMPVDAGRIIIRQSDAPITVFFVLTGEVHMIKNEKNQKGEGVVMGFLGAGDMMGD 168

  Fly   377 QALINEDKRTANIIALSPGVECLTLDRDSFKRLIGDLC---------ELKEKDYGDESRKLAMKQ 432
            ..|:...|||....| :...|.|.|....|..::|...         .||..||.|   .|...|
  Fly   169 VELLEGIKRTHTFRA-ATYCELLVLFDYDFAPILGAYMTKIWEEKKRALKALDYFD---FLDDDQ 229

  Fly   433 AQESCRDEPKEQLQQEFPDLKLTD-LEVVSTLGIGGFGRVELVKAHHQDRVDIFALKCLKKRHIV 496
            ..|:||          :..||..| |:.:....||....|..|.:.     :...|:||..:  |
  Fly   230 IVEACR----------YGRLKQFDPLDTIFCEDIGSMTNVHFVLSG-----ECLILQCLNIK--V 277

  Fly   497 DTKQEEHIFSERHIMLSSRSPFICRLYR 524
            ..|:.:.::.    :|.:....:.:::|
  Fly   278 TMKRGKKVYD----LLPASEGDVSKMFR 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkg21DNP_477213.1 Crp 183..386 CDD:223736 29/138 (21%)
CAP_ED 185..285 CDD:237999 4/24 (17%)
CAP_ED 304..419 CDD:237999 33/136 (24%)
Pkinase 457..717 CDD:278497 12/68 (18%)
STKc_cGK 463..724 CDD:270724 11/62 (18%)
S_TK_X 719..>760 CDD:214529
CG14693NP_001262467.1 Crp 90..>204 CDD:223736 29/114 (25%)
CAP_ED 97..204 CDD:237999 29/107 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0664
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.