DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkg21D and prkar2ab

DIOPT Version :9

Sequence 1:NP_477213.1 Gene:Pkg21D / 33253 FlyBaseID:FBgn0000442 Length:768 Species:Drosophila melanogaster
Sequence 2:NP_998123.1 Gene:prkar2ab / 405894 ZFINID:ZDB-GENE-040426-2427 Length:422 Species:Danio rerio


Alignment Length:265 Identity:86/265 - (32%)
Similarity:147/265 - (55%) Gaps:14/265 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 YEKDFSDKQQIKDAIMDNDFLKNIDASQVRELVDSMYSKSIAAGEFVIREGEVGAHLYVSAAGEF 230
            ::|....:|:::||.......|.::..|:.|::|||:...:..||.:|.:|:.|.:.||...|.:
Zfish   142 HQKTDEQRQRLQDACKHILLFKTLEEDQLAEVLDSMFEVLVKPGECIINQGDDGDNFYVIERGVY 206

  Fly   231 -AVMQQGKVLDKMGA---GKAFGELAILYNCTRTASIRVLSEAARVWVLDRRVFQQIMMCTGLQR 291
             .|:||..:...:|.   ..:|||||::||..|.|:||.|.|.| :|.|||..|.::::....::
Zfish   207 EIVIQQDGLQHSVGRYDHKGSFGELALMYNTPRAATIRALQEGA-LWALDRATFHRLIVKNNAKK 270

  Fly   292 IENSVNFLRSVPLL--MNLSEELLAKIADVLELEFYAAGTYIIRQGTAGDSFFLISQGNVRV--- 351
            .....:|:..||||  :.|||.:  ||.|||.:..::.|..||:||.:.|.|:::..|.||:   
Zfish   271 RRMYESFIECVPLLKSLQLSERM--KIVDVLGMRSFSDGERIIQQGDSADCFYIVESGEVRIMIR 333

  Fly   352 -TQKLTPTSPEETELRTLSRGDYFGEQALINEDKRTANIIALSPGVECLTLDRDSFKRLIGDLCE 415
             ..:......||.|:...|||.||||.||:.:..|.|::.|:. ...||.:|..:|:||:|...:
Zfish   334 SKTRACQLLQEEVEVARCSRGQYFGELALVTKRPRAASVYAVG-DTRCLVIDVQAFERLLGSCKQ 397

  Fly   416 LKEKD 420
            :.:::
Zfish   398 ILKRN 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkg21DNP_477213.1 Crp 183..386 CDD:223736 72/212 (34%)
CAP_ED 185..285 CDD:237999 37/103 (36%)
CAP_ED 304..419 CDD:237999 42/120 (35%)
Pkinase 457..717 CDD:278497
STKc_cGK 463..724 CDD:270724
S_TK_X 719..>760 CDD:214529
prkar2abNP_998123.1 DD_RII_PKA 5..41 CDD:213046
Crp 157..>266 CDD:223736 37/109 (34%)
CAP_ED 161..274 CDD:237999 37/113 (33%)
Crp 281..>392 CDD:223736 42/113 (37%)
CAP_ED 283..403 CDD:237999 42/123 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0664
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.