DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkg21D and Pka-C3

DIOPT Version :9

Sequence 1:NP_477213.1 Gene:Pkg21D / 33253 FlyBaseID:FBgn0000442 Length:768 Species:Drosophila melanogaster
Sequence 2:NP_730083.2 Gene:Pka-C3 / 39733 FlyBaseID:FBgn0000489 Length:583 Species:Drosophila melanogaster


Alignment Length:346 Identity:136/346 - (39%)
Similarity:203/346 - (58%) Gaps:21/346 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   412 DLCELKEKDYGDESRKLAMKQAQESCRDEPKE----QLQQEFPDLKLTDLEVVSTLGIGGFGRVE 472
            |..|..|:|.|:|:       ..|...||.:|    |..:......|.|.:::.|:|.|.||||.
  Fly   232 DSSESIEEDDGNET-------DDEEDDDESEESSSVQTAKGVRKYHLDDYQIIKTVGTGTFGRVC 289

  Fly   473 LVKAHHQDRVD--IFALKCLKKRHIVDTKQEEHIFSERHIMLSSRSPFICRLYRTFRDEKYVYML 535
            |.:    ||:.  ..|:|.|....::..||.||:.:||:|:...|.||:..|..:.:|:..:||:
  Fly   290 LCR----DRISEKYCAMKILAMTEVIRLKQIEHVKNERNILREIRHPFVISLEWSTKDDSNLYMI 350

  Fly   536 LEACMGGEIWTMLRDRGSFEDNAAQFIIGCVLQAFEYLHARGIIYRDLKPENLMLDERGYVKIVD 600
            .:...|||::|.||:.|.|....:.|....::.|.||||:..|:|||||||||:::..|::||.|
  Fly   351 FDYVCGGELFTYLRNAGKFTSQTSNFYAAEIVSALEYLHSLQIVYRDLKPENLLINRDGHLKITD 415

  Fly   601 FGFAKQIGTSSKTWTFCGTPEYVAPEIILNKGHDRAVDYWALGILIHELLNGTPPFSAPDPMQTY 665
            |||||::  ..:|||.||||||:|||||.:|||::|||:||||:||:|:|.|.|||....|...|
  Fly   416 FGFAKKL--RDRTWTLCGTPEYIAPEIIQSKGHNKAVDWWALGVLIYEMLVGYPPFYDEQPFGIY 478

  Fly   666 NLILKGIDMIAFPKHISRWAVQLIKRLCRDVPSERLGYQTGGIQDIKKHKWFLGFDWDGLASQLL 730
            ..||.|  .|.:.:|:...|..|||:|..:..::|||....|..|:|:|:||...:|:.:.|:.|
  Fly   479 EKILSG--KIEWERHMDPIAKDLIKKLLVNDRTKRLGNMKNGADDVKRHRWFKHLNWNDVYSKKL 541

  Fly   731 IPPFVRPIAHPTDVRYFDRFP 751
            .||.:..:.|..|.:.||.:|
  Fly   542 KPPILPDVHHDGDTKNFDDYP 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkg21DNP_477213.1 Crp 183..386 CDD:223736
CAP_ED 185..285 CDD:237999
CAP_ED 304..419 CDD:237999 2/6 (33%)
Pkinase 457..717 CDD:278497 111/261 (43%)
STKc_cGK 463..724 CDD:270724 113/262 (43%)
S_TK_X 719..>760 CDD:214529 10/33 (30%)
Pka-C3NP_730083.2 PTZ00263 262..583 CDD:140289 125/309 (40%)
STKc_PRKX_like 272..563 CDD:270763 124/299 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440855
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24353
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.