DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pkg21D and LOC110438932

DIOPT Version :9

Sequence 1:NP_477213.1 Gene:Pkg21D / 33253 FlyBaseID:FBgn0000442 Length:768 Species:Drosophila melanogaster
Sequence 2:XP_021328180.1 Gene:LOC110438932 / 110438932 -ID:- Length:105 Species:Danio rerio


Alignment Length:103 Identity:53/103 - (51%)
Similarity:68/103 - (66%) Gaps:2/103 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 YAAGTYIIRQGTAGDSFFLISQGNVRVTQKLTPTSPEETELRTLSRGDYFGEQALINEDKRTANI 389
            |:.|.||||||..||:||:||:|.|.||::..|.. ....||.|.:||:|||:||..||.||||:
Zfish     3 YSDGEYIIRQGARGDTFFIISKGKVNVTREDAPNG-TPVYLRALGKGDWFGEKALQGEDIRTANV 66

  Fly   390 IALSPGVECLTLDRDSFKRLIGDLCELKEKDYGDESRK 427
            || :..|.||.:||:|||.|||.|.::..|.|.|...|
Zfish    67 IA-AEAVTCLVIDRESFKHLIGGLDDVSNKGYDDAGAK 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pkg21DNP_477213.1 Crp 183..386 CDD:223736 31/60 (52%)
CAP_ED 185..285 CDD:237999
CAP_ED 304..419 CDD:237999 49/93 (53%)
Pkinase 457..717 CDD:278497
STKc_cGK 463..724 CDD:270724
S_TK_X 719..>760 CDD:214529
LOC110438932XP_021328180.1 CAP_ED 2..87 CDD:237999 46/85 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D123183at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.