DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3544 and Gk1

DIOPT Version :9

Sequence 1:NP_001259842.1 Gene:CG3544 / 33252 FlyBaseID:FBgn0031279 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_524655.1 Gene:Gk1 / 43913 FlyBaseID:FBgn0025592 Length:538 Species:Drosophila melanogaster


Alignment Length:470 Identity:99/470 - (21%)
Similarity:156/470 - (33%) Gaps:124/470 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 LVKQGADMHTVVSIAGAAQQHGCVFWSELGLRRLCNLNVNLRLHEQITESAFELTRTPTWRDSST 147
            ||..|..:..:::|....|:...|.|..                    .|...|.....|.|:.|
  Fly    82 LVAVGGKVEEIITIGITNQRESTVVWDR--------------------NSGQPLVNAIIWLDNRT 126

  Fly   148 DVQVREMEHTVGGPAE----LSKITGSRAYTRFTGPQIR------KVYTQCPEQYERTSRISLIS 202
            ...|.|:..|:...|.    |..:.|......|:|.::|      .|.:|..|  :.|:....|.
  Fly   127 TSTVEELLETIPNNARNINYLRPLCGLPLSPYFSGVKLRWLRDNVPVVSQAME--KGTAMFGTID 189

  Fly   203 SFLASLLIG----GIASIDYSDGSGMNLLDIRKKKWSAACLDACAPDLARRLMKPIPSSR----- 258
            ::|...|.|    |:...|.::.|...|::|...:|.|..|....  |.:.::..|.||.     
  Fly   190 TWLMYNLTGGKDCGVHKTDVTNASRTMLMNIETLQWDANLLKFFG--LPKTILPEICSSSEFYGS 252

  Fly   259 -----LQGRIGDYYVKRWNFRPDCMVVASTGSKASELAG--LLVEND---------FLMLSLDTS 307
                 ||| ||              :.:..|.:.:.|.|  .|.:..         ||:.:...|
  Fly   253 IAQGVLQG-IG--------------ITSVLGDQQAALVGQQCLAKGQAKATYGTGCFLLYNTGPS 302

  Fly   308 DVVVMPLKKAPRLEDGHVMCHPTRRDEYMGLLCFQNGGLTRKAI-------CEDVAGGSWRHFYE 365
            .|                  |.|.     |||......|.|||:       ...:||.::....:
  Fly   303 IV------------------HSTH-----GLLTTVGYQLGRKAVPFYALEGSVSIAGAAFNWLRD 344

  Fly   366 MLDATPSGNNGNVAV------HFRDREIIPTAKGTLR--WDAHISPMSAECIRGLHRFSTPEIEV 422
            .::...  |:|.:..      :..|...:|...|...  |:..    :...|.||...:|.|..|
  Fly   345 NMNLIQ--NSGQIETMASTVDNSLDVYFVPAFNGLYAPYWNQD----ARGVICGLSEETTSEHIV 403

  Fly   423 RALIEGQIMHHWSIAHEMGFH---HTPNTKIIVVGEDSRCQSVLQIVADIFNAPVYQRTGVEVSL 484
            ||.:|........|...|  |   ..|..|::|.|..:.....||:.:|:....|.:....|.:.
  Fly   404 RATLEAVCFQVRDILDSM--HKDCKIPLAKLMVDGGMTVNNLFLQLQSDLVGIQVLRAKIAETTA 466

  Fly   485 LGCAFRARYAFYEHR 499
            ||.|. |.|...|:|
  Fly   467 LGAAM-AAYKAVENR 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3544NP_001259842.1 FGGY_D-XK_euk 13..493 CDD:212660 96/462 (21%)
XylB 15..494 CDD:273550 96/463 (21%)
Gk1NP_524655.1 glycerol_kin 18..522 CDD:273549 99/470 (21%)
FGGY_GK1-3_metazoa 18..522 CDD:212664 99/470 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443077
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10196
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.