DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3544 and CG11594

DIOPT Version :9

Sequence 1:NP_001259842.1 Gene:CG3544 / 33252 FlyBaseID:FBgn0031279 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_001261391.1 Gene:CG11594 / 38473 FlyBaseID:FBgn0035484 Length:548 Species:Drosophila melanogaster


Alignment Length:522 Identity:100/522 - (19%)
Similarity:168/522 - (32%) Gaps:194/522 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 QITESAFELTRT----PTWRDSSTD------VQVREMEHTVGGPAELSKITG----SRAYTRFTG 178
            ::.|.|.:..:|    |.:.:.|:|      .||  ::..:|| .:.||:.|    :.......|
  Fly    27 RVLEQAVQTIQTWNPEPGYYNQSSDNIWQSICQV--VKKVIGG-VDKSKVKGIGFDATCSLVVLG 88

  Fly   179 PQIRKVYTQCPEQYERT----------SRISLISSFLASLL--IGGIASIDYSDGSGMNLLDIRK 231
            ||...:......:.|:.          .....|::|..|||  :||..|::         :::.|
  Fly    89 PQGSPLTVSKSGEAEQNIILWMDHRAEQETQEINAFKHSLLKYVGGQVSLE---------MEVPK 144

  Fly   232 KKWSAACLDACAPDLARRLMKPIPSSRLQGRIGDYY---------------------VKRWNFRP 275
            ..|           |.|.|      |:..|.|...:                     |.:||:. 
  Fly   145 LLW-----------LKRNL------SQTFGNIWRVFDLPDFLTWRATGVDTRSLCSVVCKWNYD- 191

  Fly   276 DCMVVASTGS------KASELAGLLVENDFLMLSLD----------------------TSDVVVM 312
                 |:.||      |.::|.. |.:|:|..|..|                      ::..|| 
  Fly   192 -----AANGSWNKEFLKQADLEE-LTQNNFEKLGSDVQPPGRTVGKGLTAKAAGELGLSAGTVV- 249

  Fly   313 PLKKAPRLEDGHV------MCHPTR---RDEYMGLLCFQNG------GLTRKAICEDVAGGSWRH 362
                :..|.|.|.      .|....   .|:..|.:....|      .:|||| |  .|.|.|..
  Fly   250 ----STSLIDAHAGALGMFGCRSKESKGADDVQGKMALIAGTSTCHMSITRKA-C--FAQGVWGP 307

  Fly   363 FYEMLDATPSG---NNG--NVAVHFRD--------------------------REIIP------- 389
            :.   ||...|   |.|  ::|.|..|                          .:::|       
  Fly   308 YQ---DAIIPGYFLNEGGQSIAGHLLDHVLKSHESYAELKSQLGEDKFIYQHLNKLLPELAAARG 369

  Fly   390 -TAKGTLRWDAHI--------SPMSAECIRGL-----HRFSTPEIEVRALIEGQIMHHWS---IA 437
             :..|.|..|.|:        ||::...:||:     ....|..:.::.|...|.:.:.:   |.
  Fly   370 LSQVGCLTQDVHVWPDLHGNRSPIADPTLRGVITGLDMTRGTESLAIKYLAFVQALAYGTRHIIE 434

  Fly   438 HEMGFHHTPNTKIIVVGEDSRCQSVLQIVADIFNAPVYQRTGVEVSLLGCAF--RARYAFYEHRE 500
            :...:...|...::..|..::....:|..|||.|.|.......|:.|:|.|.  .|....::..|
  Fly   435 NLYQYGRAPFQTLLFCGGLAKNPLYVQCHADICNLPALIPDEQEMVLVGAAALGAAASGHFDSLE 499

  Fly   501 SA 502
            ||
  Fly   500 SA 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3544NP_001259842.1 FGGY_D-XK_euk 13..493 CDD:212660 97/511 (19%)
XylB 15..494 CDD:273550 97/512 (19%)
CG11594NP_001261391.1 FGGY_YpCarbK_like 5..540 CDD:212663 100/522 (19%)
5C_CHO_kinase 6..540 CDD:273552 100/522 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443085
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.