DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3544 and CG8298

DIOPT Version :9

Sequence 1:NP_001259842.1 Gene:CG3544 / 33252 FlyBaseID:FBgn0031279 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_610718.1 Gene:CG8298 / 36282 FlyBaseID:FBgn0033673 Length:596 Species:Drosophila melanogaster


Alignment Length:493 Identity:95/493 - (19%)
Similarity:157/493 - (31%) Gaps:143/493 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 VVSIAGAAQQHGCVFWSELGLRRLCNLNVNLRLHEQITESAFELTRTPTWRDSSTDVQVREMEHT 157
            :::|....|:...|.|         ||.....||..|           .|.|..:...::.:.|.
  Fly    85 IIAIGIVNQRGTSVLW---------NLETGQPLHNAI-----------GWSDCRSTPILKTLLHN 129

  Fly   158 VGGPAELSKI-TGSRAYTRFTGPQIRKVYTQCPEQ----YERTSRISLISSFLASLLIGGIA--- 214
            |....:..:. :|....:.|:..:||.:....|..    .|.......:.|:|...|.||:.   
  Fly   130 VRHNVDYVRYRSGLPLSSCFSALKIRWLMDHVPAVATAIEENKCLFGTLDSWLLWNLTGGVEMGV 194

  Fly   215 -SIDYSDGSGMNLLDIRKKKWSAACLDACAPDLARRLMKP---IPSSRLQGRIGDYYVKRWNFRP 275
             |.|.::....:|:::..::|.        |.|.:....|   :|..|....|..|.::    .|
  Fly   195 HSTDITNAHYTSLMNVSTEQWD--------PKLCQFFRLPLNILPRIRSNSEIFGYVLE----GP 247

  Fly   276 --DCMVVASTGSKASELAG-LLVENDFLMLSLDTSDVVVMPLKKAPRLEDGHVMCHPTRRDEYMG 337
              ...:.|..|.:.:.|.| |.|:....:.:||.|..|:        |..|.     .:.|...|
  Fly   248 LHGTPIAAMMGEQPASLLGQLCVKAGQNVCTLDDSCFVL--------LNTGR-----EKLDSANG 299

  Fly   338 LLCFQNGGLTRKAICEDVAGGSWRHFYEMLDATPSGNNGNVAVHFRDREIIPT------------ 390
            |:.    |:..| :.|..|..     |.:..|.  .|.|:.....||:..|.|            
  Fly   300 LIT----GIAHK-LGEKAATN-----YTLEGAI--SNAGSTVTWLRDKLQINTEINSNDNVVESL 352

  Fly   391 -----AKGTLRWDAHISPMSAECIRGLHRFSTPEIEVRALIEGQIMHHWSIAHEMGFHHTPNTKI 450
                 ....:......|.::|||.....|   .||.......|....:|        .|  :.:.
  Fly   353 NTFIGENSMISSSCSSSMLNAECGLAAKR---SEITFVPAFHGMYAPYW--------RH--DARG 404

  Fly   451 IVVGEDSRCQSVLQIVADIFNAPVYQRTGVEVSLLGCAFRARYAFYEHRESACNCHSCMMPTGRR 515
            |::|..|      |..|:......|:.||.::      |....||  .|::.....|.|.|.   
  Fly   405 IILGLTS------QTTAENITQAAYEATGFQI------FEVLQAF--KRDTPNWDRSSMQPV--- 452

  Fly   516 TRLSFD----------EFFRDV------------PSGL 531
              |:|.          :|..|:            |:||
  Fly   453 --LTFGGDYAENLHLVQFIADIIGYMLERPQTTSPAGL 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3544NP_001259842.1 FGGY_D-XK_euk 13..493 CDD:212660 82/431 (19%)
XylB 15..494 CDD:273550 82/432 (19%)
CG8298NP_610718.1 FGGY_GK 12..534 CDD:198347 95/493 (19%)
glycerol_kin 21..543 CDD:273549 95/493 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443081
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10196
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.