DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr21a and Gr8a

DIOPT Version :9

Sequence 1:NP_001259841.1 Gene:Gr21a / 33251 FlyBaseID:FBgn0041250 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster


Alignment Length:421 Identity:84/421 - (19%)
Similarity:153/421 - (36%) Gaps:121/421 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LVLFQIMGV--MPIHRNPPEKNLPRTGYSWGSKQVM-WAIFIYSCQTTIVVLVLRERVKKFVTSP 139
            |.|:|::|.  :|:   |.:.|..||     .:::| |::|:....:.:|:..|... ::|:...
  Fly    13 LRLYQVLGFHGLPL---PGDGNPART-----RRRLMAWSLFLLISLSALVLACLFSG-EEFLYRG 68

  Fly   140 DKRF---DEAIYNVIFISL-LFTNFLLPVASWRHGPQVAIFKNMWTNYQYKFFKTTGSPIVFPNL 200
            | .|   ::|: ..:|..| :...:|..::|.||      ..|.|    :..||..|......:|
  Fly    69 D-MFGCANDAL-KYVFAELGVLAIYLETLSSQRH------LANFW----WLHFKLGGQKTGLVSL 121

  Fly   201 YPLTWSLC---VFSWLL---SIAINLS----QYFLQPDFRLWYTFAYYPIIAMLNCFCSLWYINC 255
            .......|   :|.:.:   .:||:|.    |...|.....|.|  |.|::         |.   
  Fly   122 RSEFQQFCRYLIFLYAMMAAEVAIHLGLWQFQALTQHMLLFWST--YEPLV---------WL--- 172

  Fly   256 NAFGTASRALS-----DALQTTIRG-EKPAQKLTEYRHLWVD-----------LSHMMQQLGRAY 303
                |..|.|.     :.|:..:.| |:....|.||.....:           |...:.|..|.|
  Fly   173 ----TYLRNLQFVLHLELLREQLTGLEREMGLLAEYSRFASETGRSFPGFESFLRRRLVQKQRIY 233

  Fly   304 SNMYGM---------YCLVIFFTTI---IAT------YGSISEIIDHG-----ATYKEVGLFVIV 345
            |::|.|         :.::....||   ||.      |...:.:|::.     ....|:..|:..
  Fly   234 SHVYDMLKCFQGAFNFSILAVLLTINIRIAVDCYFMYYSIYNNVINNDYYLIVPALLEIPAFIYA 298

  Fly   346 FY-CMGLLYIICNEAHYASRKVGL----DFQTKLLNINLTAVDAATQKEVEMLLVAINKNPPIMN 405
            .. ||.::..|.::.|......|.    |...::.|.:|..:                 :.|| .
  Fly   299 SQSCMVVVPRIAHQLHNIVTDSGCCSCPDLSLQIQNFSLQLL-----------------HQPI-R 345

  Fly   406 LD--GYANINRELITTNISFMATYLVVLLQF 434
            :|  |...::..|:|.....:.||::..:||
  Fly   346 IDCLGLTILDCSLLTRMACSVGTYMIYSIQF 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr21aNP_001259841.1 7tm_7 75..438 CDD:285581 84/421 (20%)
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 82/419 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.