DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr21a and Gr10a

DIOPT Version :9

Sequence 1:NP_001259841.1 Gene:Gr21a / 33251 FlyBaseID:FBgn0041250 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_727523.1 Gene:Gr10a / 117501 FlyBaseID:FBgn0045502 Length:408 Species:Drosophila melanogaster


Alignment Length:454 Identity:81/454 - (17%)
Similarity:130/454 - (28%) Gaps:205/454 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 VTSPDKRFDEAIYNVIFISLLFTNFLLPVASWRHGPQVAIFKNMWTNYQYKFFKTTGSPIVFPNL 200
            :||||:|                                  |:.|..:::||::       :.::
  Fly     1 MTSPDER----------------------------------KSFWERHEFKFYR-------YGHV 24

  Fly   201 YPLTWSLCVFSWLLSIAINLSQYFLQPDFRLWYTFAYYPIIAMLNCFCSLWYINCNAFGTASRAL 265
            |.|.:...|..::...|:......|        ..||..:.:||.......|. |..|.|.:..|
  Fly    25 YALIYGQVVIDYVPQRALKRGVKVL--------LIAYGHLFSMLLIVVLPGYF-CYHFRTLTDTL 80

  Fly   266 SDALQ-----------------------TTIRGEKPAQKLTEYR-HLWVDLSHMMQQLGRAYS-N 305
            ...||                       .|:..|...|:.|..| ||..:..:..|:..|.:. .
  Fly    81 DRRLQLLFYVSFTNTAIKYATVIVTYVANTVHFEAINQRCTMQRTHLEFEFKNAPQEPKRPFEFF 145

  Fly   306 MYGMYCLV-----IFFTTIIATY-----GSISEIIDHGATYKEV--------------------- 339
            ||..:||:     |....|.|.|     ||:|::..|.|.|..|                     
  Fly   146 MYFKFCLINLMMMIQVCGIFAQYGEVGKGSVSQVRVHFAIYAFVLWNYTENMADYCYFINGSVLK 210

  Fly   340 -----------------GL---FVIVFYCMGL------LYIICNEAHYASRK---------VGLD 369
                             ||   .:::.:|..|      |...|.|.|...|:         :||.
  Fly   211 YYRQFNLQLGSLRDEMDGLRPGGMLLHHCCELSDRLEELRRRCREIHDLQRESFRMHQFQLIGLM 275

  Fly   370 FQTKLLN------------------------------------------------INLTAV---- 382
            ..|.:.|                                                :.|.||    
  Fly   276 LSTLINNLTNFYTLFHMLAKQSLEEVSYPVVVGSVYATGFYIDTYIVALINEHIKLELEAVALTM 340

  Fly   383 ---------DAATQKEVEML-LVAINKNPPIMNLDGYANINRELITTNISFMATYLVVLLQFKI 436
                     |....:|:|.| |..:|..||:  |.|..:::|.|:........:|.:.|:||.:
  Fly   341 RRFAEPREMDERLTREIEHLSLELLNYQPPM--LCGLLHLDRRLVYLIAVTAFSYFITLVQFDL 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr21aNP_001259841.1 7tm_7 75..438 CDD:285581 81/454 (18%)
Gr10aNP_727523.1 7tm_7 20..402 CDD:285581 72/399 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.